SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PYU1_T006319 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006319
Domain Number 1 Region: 26-185
Classification Level Classification E-value
Superfamily E set domains 1.54e-35
Family RhoGDI-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006319
Sequence length 236
Comment protein Name="PYU1_T006319" Note="Similar to UNC119: Protein unc-119 homolog A (Canis familiaris)" AED:0.165422481878178 QI:0|0|0|0.5|1|1|2|0|236
Sequence
MARKRYTPDDVLELEAPTDSFLCPLSANTYGIEFLHFAISDYESKRKIFEIGKNRPGKAV
PKVDLSQARGEAAYRTIRYEFSEDVLRLPAIKTELEFSVGPKEVHELRMIERHYFRDEIV
KSYDFTFGFCIPSSVNTWDAIYSMPPLDEELISSMIAQPYATVSDSFYFVGDELIMHNKA
EYKYIPEDSAQAKKSYYTSDDEDDSKDSKSSRADSKGSGAKGPDSPAKWSKEDDYD
Download sequence
Identical sequences K3WMX7
PYU1_T006319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]