SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PYU1_T010740 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T010740
Domain Number 1 Region: 127-242,292-365
Classification Level Classification E-value
Superfamily E set domains 3.41e-43
Family Cytoplasmic domain of inward rectifier potassium channel 0.00047
Further Details:      
 
Weak hits

Sequence:  PYU1_T010740
Domain Number - Region: 61-145
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000112
Family Voltage-gated potassium channels 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T010740
Sequence length 374
Comment protein Name="PYU1_T010740" Note="Similar to KCNJ12: ATP-sensitive inward rectifier potassium channel 12 (Homo sapiens)" AED:0.156067076607096 QI:0|0.25|0.2|0.4|1|1|5|184|374
Sequence
MGSADQPLLPTAGAHNPSINYASSGLRARRKRFIDRSGKFSQSTGKYNVYRSGGDWRQIY
YQDVFNTLIHTKTKRIVTGIFVMYFFVILFFAILYLDVSRRYGTCNVGLSTMMESYIFSL
ETISFAGIFLDSICIGIFYARFARANKRASTIMFTNSAVIRRIRGSYYLMFQVCERRKHQ
LVEAHVRLYAVRHEFDDEGNAESLFQCHQMRVQQPDDDTGAMLLMVLPQVIVHRIDPWSP
LFPPECLPADGHYPNVCPSFPDPSQRIIDMENGNRDGLGNGAQLPYKQPTRSQILNHLRN
SELEVIAVLEGIDASTSNTMQARYSYTDEDIVWDMMFENCVSKTLDGVHINFNKFHLLKP
VPEDVHRCTSVSMF
Download sequence
Identical sequences K3X0J1
PYU1_T010740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]