SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PYU1_T012226 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T012226
Domain Number 1 Region: 27-138,190-205
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.96e-28
Family Calcium ATPase, transmembrane domain M 0.0026
Further Details:      
 
Domain Number 2 Region: 138-181
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000000000392
Family Calcium ATPase, transduction domain A 0.0036
Further Details:      
 
Domain Number 3 Region: 232-274
Classification Level Classification E-value
Superfamily HAD-like 0.0000247
Family Meta-cation ATPase, catalytic domain P 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T012226
Sequence length 276
Comment protein Name="PYU1_T012226" Note="Similar to AHA7: ATPase 7, plasma membrane-type (Arabidopsis thaliana)" AED:0.254884547069272 QI:0|0|0|1|1|1|2|0|276
Sequence
MAGGGNSYMSMATPNDQKNYTNEVGQIQWGSIPLNAALDKLKTSREGLTNDEAQKRIAEY
GPNKLPEEKVNKLMVFLSFMWNPLSWAMEVAAILSIVLLDYSDFGLILFLLLLNAIIGYL
EEIQAGDAVSALMGQLAPEAKVFRNGEIVNISADQLVPGDVIRVRLGDVIPADLKFLEGD
AVKIVLDMDVDADTLRNTVEERIDEFASRGYRGLGVALDRSGDVPVEQCQWKMVGLLPLF
DPPRHDTADTVKKAIQLGIAVKMVTGDQRAIAVETC
Download sequence
Identical sequences K3X4S7
PYU1_T012226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]