SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556586432|ref|YP_008754016.1| from Spiribacter sp. UAH-SP71

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556586432|ref|YP_008754016.1|
Domain Number 1 Region: 8-311
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 4.32e-83
Family Acetamidase/Formamidase-like 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|556586432|ref|YP_008754016.1|
Sequence length 316
Comment hypothetical protein SPICUR_03695 [Spiribacter sp. UAH-SP71]
Sequence
MPAPHHLTATPDTVAWGYLDVARPAVLHVQSGDEVVIDTLSGEPENLPADPARVLPDHRA
VLEAQRKERGEGVHHLTGPIHVDGARPGDCLQIDILAATPRQDWGFCEILPLKGILPGEF
TDYQQILIDIDRARNRATLPWGQSFALDPFFGIMAVAPPPEWGRLASPVPWAFGGNIDNR
ALVPGTTLYLPVFNDGALFSVGDGHGRQGDGEVCIDALETALQGRFRLTVRRDIEASAPF
AETPSHWISMGLHPTLDQAAEEAVRQMVQLLTTRTGLDRSQAYMMTSMLGDLRITQVVDG
NKGVHMLYPKEATHSP
Download sequence
Identical sequences U5T2T5
gi|556586432|ref|YP_008754016.1| WP_023366172.1.14812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]