SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410470908|ref|YP_006894189.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410470908|ref|YP_006894189.1|
Domain Number 1 Region: 96-234
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.71e-24
Family GntR ligand-binding domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.92e-19
Family GntR-like transcriptional regulators 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410470908|ref|YP_006894189.1|
Sequence length 254
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MEPGVDGARKQIAEVVAERIERLILDGVLKAGQALPSERRLTEKLGVSRTALREGLRVLR
ARQIIHTAQGKGSYVAQISQVDAGPLVHLFNSQPRTLYDLLEVRALLESESARLAAIRGT
DADFIMIRRRYDEMLAAHGRETDSATHAHLDHAFHLAICQASHNAVLVHTLQSLTDLLLG
SVFACVNNLYHREPHKRHIDQQHERLFLAVLAREPEQAHQAARAHVDSVRQSLAEIEQEE
QRLVRATLRLEGWV
Download sequence
Identical sequences A0A063TQT5 A0A0C6P9G9 A0A1M8I4F6 K0MCK2
WP_003806985.1.101424 WP_003806985.1.14246 WP_003806985.1.1660 WP_003806985.1.17334 WP_003806985.1.17359 WP_003806985.1.19828 WP_003806985.1.20111 WP_003806985.1.21837 WP_003806985.1.22732 WP_003806985.1.23701 WP_003806985.1.24339 WP_003806985.1.27032 WP_003806985.1.30681 WP_003806985.1.31572 WP_003806985.1.31632 WP_003806985.1.32589 WP_003806985.1.37794 WP_003806985.1.38534 WP_003806985.1.40806 WP_003806985.1.42576 WP_003806985.1.43400 WP_003806985.1.43447 WP_003806985.1.47170 WP_003806985.1.50287 WP_003806985.1.54628 WP_003806985.1.56782 WP_003806985.1.5701 WP_003806985.1.57255 WP_003806985.1.58338 WP_003806985.1.63136 WP_003806985.1.63299 WP_003806985.1.63717 WP_003806985.1.63791 WP_003806985.1.64622 WP_003806985.1.65401 WP_003806985.1.66177 WP_003806985.1.67928 WP_003806985.1.69310 WP_003806985.1.69835 WP_003806985.1.71104 WP_003806985.1.71382 WP_003806985.1.71489 WP_003806985.1.72041 WP_003806985.1.72199 WP_003806985.1.72302 WP_003806985.1.77807 WP_003806985.1.78117 WP_003806985.1.84958 WP_003806985.1.84976 WP_003806985.1.86585 WP_003806985.1.86646 WP_003806985.1.87218 WP_003806985.1.88542 WP_003806985.1.91389 WP_003806985.1.93987 YP_006894189.1.34978 YP_006969357.1.84680 gi|410470908|ref|YP_006894189.1| gi|412340602|ref|YP_006969357.1| gi|410417909|ref|YP_006898358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]