SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410471093|ref|YP_006894374.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410471093|ref|YP_006894374.1|
Domain Number 1 Region: 93-225
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-24
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.34e-19
Family GntR-like transcriptional regulators 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410471093|ref|YP_006894374.1|
Sequence length 231
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MLQPTPTLTDQVAGQLARAIADGAYAVGAKLPTGRALAQQYGVSAAVIREATERLRAQGL
VQSRQGSGCTVVARMPAGGFQVPAGGLDRAHLARVYELRMELEGGAAALAARRRGAADLD
RMRQALQALQREPIEPEQGVVHDVGFHVAIATATANPYYLQLLQYLNLQLRQAVETARAN
TRRQGDPVHAVHEEHLAIYRAIERGEPEAARAAAQHHLLGAAARLQLDMNL
Download sequence
Identical sequences A0A2J9U3P5 K0MC32 Q7W1Q2
gi|33595013|ref|NP_882656.1| APC88997 WP_003807438.1.1660 WP_003807438.1.17334 WP_003807438.1.17359 WP_003807438.1.21837 WP_003807438.1.23657 WP_003807438.1.24339 WP_003807438.1.26498 WP_003807438.1.29688 WP_003807438.1.50287 WP_003807438.1.63299 WP_003807438.1.63717 WP_003807438.1.84976 WP_003807438.1.87218 YP_006894374.1.34978 gi|410471093|ref|YP_006894374.1| 257311.BPP0299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]