SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410471123|ref|YP_006894404.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410471123|ref|YP_006894404.1|
Domain Number 1 Region: 97-232
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.54e-23
Family GntR ligand-binding domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 24-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000224
Family GntR-like transcriptional regulators 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410471123|ref|YP_006894404.1|
Sequence length 244
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MATSANRPLFAPIPPSMNMPLAPMARENIAAVIYRQLKQLLMMGELKPGEILTLRMLTER
LGVSQTPVREALLQLVSERALAMSRGKSVSVPAPTREKLQELRDIRLTLEVLATERATPR
ISDAEIKTLERLHREMVRYKNSEQREGVLKTNYEFHFTLYNASGMPDLVAIIEGLWAQTG
PSLTYLYQKPFAHLYDAHPHLPLIEALRRHDVEAAVAAIRRDVAGYGAALMERLPAEAGQ
PAGG
Download sequence
Identical sequences A0A0H3LGZ6 A0A2J9U3H8 K0MC53
gi|33599327|ref|NP_886887.1| gi|410471123|ref|YP_006894404.1| WP_003818987.1.101424 WP_003818987.1.15674 WP_003818987.1.19828 WP_003818987.1.21837 WP_003818987.1.22732 WP_003818987.1.23657 WP_003818987.1.23701 WP_003818987.1.26498 WP_003818987.1.29688 WP_003818987.1.31246 WP_003818987.1.31572 WP_003818987.1.32589 WP_003818987.1.33898 WP_003818987.1.37794 WP_003818987.1.38534 WP_003818987.1.40806 WP_003818987.1.42576 WP_003818987.1.43400 WP_003818987.1.47170 WP_003818987.1.50287 WP_003818987.1.56758 WP_003818987.1.56782 WP_003818987.1.5701 WP_003818987.1.58338 WP_003818987.1.63136 WP_003818987.1.63299 WP_003818987.1.63717 WP_003818987.1.63791 WP_003818987.1.64622 WP_003818987.1.65401 WP_003818987.1.66177 WP_003818987.1.67928 WP_003818987.1.69310 WP_003818987.1.69835 WP_003818987.1.71104 WP_003818987.1.71382 WP_003818987.1.72041 WP_003818987.1.72302 WP_003818987.1.77807 WP_003818987.1.82663 WP_003818987.1.86585 WP_003818987.1.86646 WP_003818987.1.88542 WP_003818987.1.91389 YP_006894404.1.34978 257310.BB0338 APC84142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]