SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410471242|ref|YP_006894523.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410471242|ref|YP_006894523.1|
Domain Number 1 Region: 75-204
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.54e-24
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000206
Family GntR-like transcriptional regulators 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410471242|ref|YP_006894523.1|
Sequence length 211
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MAPPANLRESVIAQLRSRIVSGAAAPGMIYSVPSLANELGISTTPVREALLELSRSGLVE
PLRNRGFRVQAITVQDLENHFDVRVMLESGALATLARQGLTDTAPLVALADEVAQAVKDQ
DVGQYIESDRRFHEALVARAGNPLLTRMIMHLRADMRLYGINSEEGRVRQRASVDEHYEM
IDLAVKQQPEAIVALITRHIESWKPLFAAAL
Download sequence
Identical sequences A0A0C6P8A1 A0A0H3LHA5 A0A2J9U349 K0MDF5
gi|410471242|ref|YP_006894523.1| 257310.BB0470 WP_003807782.1.15674 WP_003807782.1.1660 WP_003807782.1.17334 WP_003807782.1.17359 WP_003807782.1.19828 WP_003807782.1.20111 WP_003807782.1.21837 WP_003807782.1.23657 WP_003807782.1.24339 WP_003807782.1.26498 WP_003807782.1.27032 WP_003807782.1.29688 WP_003807782.1.30681 WP_003807782.1.32589 WP_003807782.1.37794 WP_003807782.1.38534 WP_003807782.1.40806 WP_003807782.1.50287 WP_003807782.1.54628 WP_003807782.1.57255 WP_003807782.1.58338 WP_003807782.1.63299 WP_003807782.1.63717 WP_003807782.1.64622 WP_003807782.1.66177 WP_003807782.1.69310 WP_003807782.1.71104 WP_003807782.1.71382 WP_003807782.1.71489 WP_003807782.1.72041 WP_003807782.1.72199 WP_003807782.1.72302 WP_003807782.1.78117 WP_003807782.1.82663 WP_003807782.1.84958 WP_003807782.1.84976 WP_003807782.1.86585 WP_003807782.1.87218 WP_003807782.1.88542 WP_003807782.1.91389 WP_003807782.1.93987 YP_006894523.1.34978 YP_006968991.1.84680 gi|412340236|ref|YP_006968991.1| gi|33599460|ref|NP_887020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]