SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410471422|ref|YP_006894703.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410471422|ref|YP_006894703.1|
Domain Number 1 Region: 82-224
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.68e-23
Family GntR ligand-binding domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 11-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000082
Family GntR-like transcriptional regulators 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410471422|ref|YP_006894703.1|
Sequence length 227
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MSARSAPKSQTRSSTEISEEILRRIQSGRYLPGDSLSQYELASEFGTSRTPIREALRFLE
ARRAISLTDTGRAMVAIPSVRAIREAFEVRAELEGLAARLAVDWIEDKHLKLLAQHQKHY
ASTLRSRVRNERGSEWLQHNFDFHHLITELSHNERLLDMVSELQSSSVSDVLGFASKMPP
RLMEENIQQHEAIIAALTRRDGAAAREAMIEHVLRTMRLVIDWMESR
Download sequence
Identical sequences A0A0C6P581 A0A0H3LHW2 A0A1M9D3B2 A0A261V7R1 K0M877
gi|33599692|ref|NP_887252.1| WP_003808107.1.14246 WP_003808107.1.15674 WP_003808107.1.1660 WP_003808107.1.17334 WP_003808107.1.17359 WP_003808107.1.19828 WP_003808107.1.20111 WP_003808107.1.21837 WP_003808107.1.24339 WP_003808107.1.27032 WP_003808107.1.29688 WP_003808107.1.30681 WP_003808107.1.32589 WP_003808107.1.37794 WP_003808107.1.38534 WP_003808107.1.40806 WP_003808107.1.50287 WP_003808107.1.54628 WP_003808107.1.57255 WP_003808107.1.58338 WP_003808107.1.60706 WP_003808107.1.63299 WP_003808107.1.63717 WP_003808107.1.64622 WP_003808107.1.66177 WP_003808107.1.69310 WP_003808107.1.71104 WP_003808107.1.71382 WP_003808107.1.71489 WP_003808107.1.72041 WP_003808107.1.72199 WP_003808107.1.72302 WP_003808107.1.78117 WP_003808107.1.82663 WP_003808107.1.84958 WP_003808107.1.84976 WP_003808107.1.86585 WP_003808107.1.87218 WP_003808107.1.88542 WP_003808107.1.91389 WP_003808107.1.93987 WP_003808107.1.94504 YP_006894703.1.34978 YP_006968785.1.84680 gi|412340030|ref|YP_006968785.1| gi|410471422|ref|YP_006894703.1| 257310.BB0702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]