SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410471598|ref|YP_006894879.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410471598|ref|YP_006894879.1|
Domain Number 1 Region: 44-135
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.55e-21
Family GntR-like transcriptional regulators 0.02
Further Details:      
 
Domain Number 2 Region: 115-257
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000000141
Family GntR ligand-binding domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410471598|ref|YP_006894879.1|
Sequence length 261
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MRHPRMGAGYTIRSPSWPFLPDRTSMTRQPQSADIEELPLGRTSKSLPEQVADRLMQSIQ
TGVLQPGERLKEETLSDRFAVSRTTVREAISTLERRGVIERVPRFGARVREIRADEIEEI
FCIRAQLLGLAARRVAEHGDDEILAQLRQQVERLRQLADKPSTSPASYAKVSIETQQLLI
QAVGWKQLGTMYEGLSNQMLWKTSVRGKSLSFQSQQRRRESVGDWQRLLEAVCTRDAAAA
EESAKLLLGASYRAVRGQLAS
Download sequence
Identical sequences A0A0C6P7V7 K0M8B7
WP_015039062.1.14246 WP_015039062.1.1660 WP_015039062.1.17334 WP_015039062.1.19828 WP_015039062.1.20111 WP_015039062.1.21837 WP_015039062.1.24339 WP_015039062.1.27032 WP_015039062.1.29688 WP_015039062.1.30681 WP_015039062.1.32589 WP_015039062.1.37794 WP_015039062.1.38534 WP_015039062.1.50287 WP_015039062.1.54628 WP_015039062.1.57255 WP_015039062.1.63299 WP_015039062.1.63717 WP_015039062.1.64622 WP_015039062.1.66177 WP_015039062.1.71489 WP_015039062.1.72041 WP_015039062.1.72199 WP_015039062.1.72302 WP_015039062.1.78117 WP_015039062.1.84958 WP_015039062.1.88542 WP_015039062.1.91389 WP_015039062.1.93987 YP_006894879.1.34978 YP_006968577.1.84680 gi|410471598|ref|YP_006894879.1| gi|412339822|ref|YP_006968577.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]