SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410471864|ref|YP_006895145.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410471864|ref|YP_006895145.1|
Domain Number 1 Region: 107-240
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.14e-30
Family GntR ligand-binding domain-like 0.007
Further Details:      
 
Domain Number 2 Region: 39-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000136
Family GntR-like transcriptional regulators 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410471864|ref|YP_006895145.1|
Sequence length 253
Comment transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MNDLHTRARTAPRALAGKRTTSAAEASDTAPGAPQPFLRDVAYEQIKAMLFLNEETGRAY
SERQLAAQFGLGLNPVRSAIERLKLEGLVVVVPKIGIMLPEMSANAINDFYEIRTVIESH
VALSLVGQLQPSDIERVEAILRQQEECVREGAYLDYHQLDMAFHLSLAQIHGNEEIVQML
ERLRDKMHRLSTRLHTKYPGRLGANVQQHREIFEAIKDGDAKRAQNQMRAHLVWGKRFVL
DPRSSADALLPAT
Download sequence
Identical sequences A0A0H3LVY5 A0A2J9U6R2 K0MCF7 Q7W4Y4
gi|33602931|ref|NP_890491.1| APC88727 gi|33598039|ref|NP_885682.1| gi|410471864|ref|YP_006895145.1| gi|410421422|ref|YP_006901871.1| 257310.BB3957 257311.BPP3522 WP_003814131.1.101424 WP_003814131.1.15674 WP_003814131.1.1660 WP_003814131.1.17334 WP_003814131.1.17359 WP_003814131.1.19828 WP_003814131.1.21837 WP_003814131.1.22732 WP_003814131.1.23657 WP_003814131.1.23701 WP_003814131.1.24339 WP_003814131.1.26498 WP_003814131.1.29688 WP_003814131.1.31246 WP_003814131.1.31572 WP_003814131.1.31632 WP_003814131.1.32589 WP_003814131.1.33898 WP_003814131.1.38534 WP_003814131.1.40806 WP_003814131.1.42576 WP_003814131.1.43400 WP_003814131.1.47170 WP_003814131.1.50287 WP_003814131.1.56758 WP_003814131.1.56782 WP_003814131.1.5701 WP_003814131.1.58338 WP_003814131.1.63136 WP_003814131.1.63299 WP_003814131.1.63717 WP_003814131.1.63791 WP_003814131.1.64622 WP_003814131.1.65401 WP_003814131.1.66177 WP_003814131.1.67928 WP_003814131.1.69310 WP_003814131.1.69835 WP_003814131.1.71104 WP_003814131.1.71382 WP_003814131.1.72041 WP_003814131.1.77807 WP_003814131.1.82663 WP_003814131.1.84976 WP_003814131.1.86585 WP_003814131.1.86646 WP_003814131.1.87218 WP_003814131.1.88542 YP_006895145.1.34978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]