SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410471977|ref|YP_006895258.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410471977|ref|YP_006895258.1|
Domain Number 1 Region: 97-228
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.4e-18
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 18-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000917
Family GntR-like transcriptional regulators 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410471977|ref|YP_006895258.1|
Sequence length 237
Comment GntR-family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MANFQATIHSRPLSPEFMTQARRPASTIQAVLTNLREKISLQSILPGARLTEEELVDNYS
IPRAMAREVLAVLEDRGIVRRIPNKGAVVAHVDMQWVYHYYDAREALDGMMVRLAARQTR
PEDWADLVEQFGEPFQKALETGDVDRLISLIETFRNRLQTAANNPVLSDLAERIHERIRV
VRQRVALLPGRAETMVADYRAVLAALARSDAEEAEQLMGILNRNNRAAIQKYERYVV
Download sequence
Identical sequences A0A0C6P6R9 A0A0H3LT38 K0MBL6
257310.BB1510 gi|412339259|ref|YP_006968014.1| gi|410471977|ref|YP_006895258.1| gi|33600495|ref|NP_888055.1| WP_003819919.1.101424 WP_003819919.1.15674 WP_003819919.1.1660 WP_003819919.1.17334 WP_003819919.1.19828 WP_003819919.1.20111 WP_003819919.1.21837 WP_003819919.1.22732 WP_003819919.1.23701 WP_003819919.1.24339 WP_003819919.1.29688 WP_003819919.1.30681 WP_003819919.1.31246 WP_003819919.1.31572 WP_003819919.1.31632 WP_003819919.1.32589 WP_003819919.1.33898 WP_003819919.1.37794 WP_003819919.1.38534 WP_003819919.1.40806 WP_003819919.1.42576 WP_003819919.1.43400 WP_003819919.1.43447 WP_003819919.1.47170 WP_003819919.1.54628 WP_003819919.1.56758 WP_003819919.1.56782 WP_003819919.1.57255 WP_003819919.1.58338 WP_003819919.1.63136 WP_003819919.1.63299 WP_003819919.1.63791 WP_003819919.1.64622 WP_003819919.1.65401 WP_003819919.1.66177 WP_003819919.1.67928 WP_003819919.1.69310 WP_003819919.1.69835 WP_003819919.1.71104 WP_003819919.1.71382 WP_003819919.1.71489 WP_003819919.1.72041 WP_003819919.1.72199 WP_003819919.1.72302 WP_003819919.1.77807 WP_003819919.1.82663 WP_003819919.1.84958 WP_003819919.1.84976 WP_003819919.1.86585 WP_003819919.1.86646 WP_003819919.1.87218 WP_003819919.1.88542 WP_003819919.1.91389 WP_003819919.1.93987 YP_006895258.1.34978 YP_006968014.1.84680 gi|410419255|ref|YP_006899704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]