SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410472930|ref|YP_006896211.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410472930|ref|YP_006896211.1|
Domain Number 1 Region: 80-212
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.01e-25
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 14-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.53e-17
Family GntR-like transcriptional regulators 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410472930|ref|YP_006896211.1|
Sequence length 217
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MTDANAGPLTLTADGVTDELRALILDGSLGIGVQLKQEVLAKRFGVSRIPVREALKRLEA
EGLVTHAPHQGSVVASRSVQELLETLDIRVGLESRALVLAIPHMTPAVFKEAETIIARYD
ASEFPREWSELNLEFHMCLYRPSGRPRLLKTIENLVRGIDIHLRAHQSYAVGRKSPQNEH
RAILDACIAGKAKRARDLLEAHIEHTQDVLRKEHGLI
Download sequence
Identical sequences A0A063UJD4 A0A0C6NZG9 A0A0H3LN86 A0A1M9H2Y2 K0MIE5
gi|412337538|ref|YP_006966293.1| gi|410420521|ref|YP_006900970.1| 257310.BB2377 WP_003812272.1.101424 WP_003812272.1.14246 WP_003812272.1.15674 WP_003812272.1.1660 WP_003812272.1.17334 WP_003812272.1.17359 WP_003812272.1.20111 WP_003812272.1.21837 WP_003812272.1.22732 WP_003812272.1.23701 WP_003812272.1.24339 WP_003812272.1.29688 WP_003812272.1.30681 WP_003812272.1.31246 WP_003812272.1.31572 WP_003812272.1.31632 WP_003812272.1.32589 WP_003812272.1.33898 WP_003812272.1.37794 WP_003812272.1.38534 WP_003812272.1.40806 WP_003812272.1.43400 WP_003812272.1.43447 WP_003812272.1.47170 WP_003812272.1.50287 WP_003812272.1.54628 WP_003812272.1.56758 WP_003812272.1.56782 WP_003812272.1.5701 WP_003812272.1.57255 WP_003812272.1.58338 WP_003812272.1.63136 WP_003812272.1.63299 WP_003812272.1.63717 WP_003812272.1.63791 WP_003812272.1.64622 WP_003812272.1.65401 WP_003812272.1.66177 WP_003812272.1.67928 WP_003812272.1.69310 WP_003812272.1.69835 WP_003812272.1.71104 WP_003812272.1.71382 WP_003812272.1.71489 WP_003812272.1.72041 WP_003812272.1.72199 WP_003812272.1.82663 WP_003812272.1.84958 WP_003812272.1.84976 WP_003812272.1.86585 WP_003812272.1.86646 WP_003812272.1.87218 WP_003812272.1.88542 WP_003812272.1.91389 WP_003812272.1.93987 YP_006896211.1.34978 YP_006966293.1.84680 gi|410472930|ref|YP_006896211.1| gi|33601358|ref|NP_888918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]