SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410472951|ref|YP_006896232.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410472951|ref|YP_006896232.1|
Domain Number 1 Region: 77-206
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.01e-24
Family GntR ligand-binding domain-like 0.0084
Further Details:      
 
Domain Number 2 Region: 10-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000114
Family GntR-like transcriptional regulators 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410472951|ref|YP_006896232.1|
Sequence length 226
Comment gntR-family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MRSSTDLSAEGISQAIATAIVSHRLPPGTRLREEALASVYKVSRTKIRAALLMLSKDKLI
QIVPDKGAFVSKPDAHEAREVYAVRRILEAALAREFVACAAPQDYERLEQHLHQEREAIH
EGDVQRRNQLLAGFHLQLAEIVGNSVLTAMLHELLARTAVITVMYQSAHDASCSSQEHYA
FLAAARDGDAERACALMDEHLLHLQTALDFDGAPAPNRDLVAALLS
Download sequence
Identical sequences A0A2J9U0Z5 K0MIH3 Q7WAN7
257311.BPP1337 gi|33595997|ref|NP_883640.1| WP_010927987.1.17334 WP_010927987.1.19828 WP_010927987.1.23657 WP_010927987.1.24339 WP_010927987.1.26498 WP_010927987.1.27032 WP_010927987.1.32589 WP_010927987.1.37794 WP_010927987.1.38534 WP_010927987.1.58338 WP_010927987.1.64622 WP_010927987.1.66177 WP_010927987.1.72041 WP_010927987.1.72302 WP_010927987.1.78117 WP_010927987.1.84976 WP_010927987.1.87218 WP_010927987.1.91389 YP_006896232.1.34978 gi|410472951|ref|YP_006896232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]