SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410473122|ref|YP_006896403.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410473122|ref|YP_006896403.1|
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.79e-18
Family GntR-like transcriptional regulators 0.025
Further Details:      
 
Domain Number 2 Region: 78-219
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.04e-16
Family GntR ligand-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410473122|ref|YP_006896403.1|
Sequence length 230
Comment regulatory protein [Bordetella parapertussis Bpp5]
Sequence
MKNAKNGRTLNAEVYAQLRAQILTGQFMPRQRLKVSQLSEQHGVSLNVVREALNRLAGEQ
LVELQPQFGFAVRGLSAEDLVDLFEQRGVVESLALRQSIARGDLNWQSDVVAAHHRLGGT
AVVSPDDPQKLNPEWLARHEEFNLVMMRACGSPRLLQIVRQLAEASAIYQRALLPLAAVA
AELETEHDDLLQRILDGDADGAVRVLLKHMEQTRDAMLPFLVQQEVAGQA
Download sequence
Identical sequences A0A0C6P2G1 A0A0H3LW07 K0M994
gi|412337863|ref|YP_006966618.1| WP_003811568.1.14246 WP_003811568.1.15674 WP_003811568.1.1660 WP_003811568.1.17334 WP_003811568.1.17359 WP_003811568.1.19828 WP_003811568.1.20111 WP_003811568.1.21837 WP_003811568.1.24339 WP_003811568.1.30681 WP_003811568.1.32589 WP_003811568.1.37794 WP_003811568.1.38534 WP_003811568.1.40806 WP_003811568.1.50287 WP_003811568.1.54628 WP_003811568.1.57255 WP_003811568.1.58338 WP_003811568.1.63299 WP_003811568.1.63717 WP_003811568.1.64622 WP_003811568.1.66177 WP_003811568.1.69310 WP_003811568.1.71104 WP_003811568.1.71382 WP_003811568.1.71489 WP_003811568.1.72041 WP_003811568.1.72199 WP_003811568.1.72302 WP_003811568.1.82663 WP_003811568.1.84958 WP_003811568.1.84976 WP_003811568.1.86585 WP_003811568.1.87218 WP_003811568.1.91389 WP_003811568.1.93987 YP_006896403.1.34978 YP_006966618.1.84680 257310.BB2719 gi|410473122|ref|YP_006896403.1| gi|33601696|ref|NP_889256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]