SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410473185|ref|YP_006896466.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410473185|ref|YP_006896466.1|
Domain Number 1 Region: 86-220
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.97e-23
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 14-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.4e-19
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410473185|ref|YP_006896466.1|
Sequence length 229
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MDAMTGTSKPNATSGSTLEYVVDTLRQGILSGRLVPGQRLVEADLTRQLGVSRGPVRESF
RRLSAEGLVESIPNQTTMVRRYSKAEMLELFEIRAELEALAARRAAECMDDPAAKARFLQ
AIGPIWDEHSLAAAPSYFDENRRFHQAIADLSANTQLAELIRKLQLPLIMFQLGGAITPQ
AIQASIDEHRRIAQAIVDGNGRKAAAEVKAHLKRACEMVERMPPDIFRP
Download sequence
Identical sequences A0A1M9E319 K0MGT4
YP_006896466.1.34978 gi|410473185|ref|YP_006896466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]