SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410474031|ref|YP_006897312.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410474031|ref|YP_006897312.1|
Domain Number 1 Region: 86-223
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.88e-22
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 16-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.01e-16
Family GntR-like transcriptional regulators 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410474031|ref|YP_006897312.1|
Sequence length 232
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MKEKPITAIDKNGIDAPLTDVVYQRMLDGIYAGGLPPGGVINEVELAREFGVSRGPVREA
VRRLQGIQIVTREPYMKARVVAMSAESALELFQMRMGLEGVACFLATQRMSDADIAQLQR
DMDAHYQSWAARREGAPNGEERHFDLHERIVRASGNKRIIAALCEDLYHLLRIYRRHSGS
ALERKDDAYDEHWQIVRAIASRDARLAESLMRSHIERAANHVASQLREPAIQ
Download sequence
Identical sequences A0A063UUM9 A0A0C6P5Z0 A0A0H3LKN3 A0A1M8XCM2 A0A2J9U1H7 K0MH50 Q7WB71
257310.BB1351 257311.BPP1135 gi|33595810|ref|NP_883453.1| APC88723 gi|410474031|ref|YP_006897312.1| gi|33600337|ref|NP_887897.1| gi|410419101|ref|YP_006899550.1| gi|412339415|ref|YP_006968170.1| WP_003809388.1.101424 WP_003809388.1.14246 WP_003809388.1.15674 WP_003809388.1.1660 WP_003809388.1.17334 WP_003809388.1.17359 WP_003809388.1.19828 WP_003809388.1.20111 WP_003809388.1.21837 WP_003809388.1.22732 WP_003809388.1.23657 WP_003809388.1.23701 WP_003809388.1.24339 WP_003809388.1.26498 WP_003809388.1.27032 WP_003809388.1.29688 WP_003809388.1.30681 WP_003809388.1.31246 WP_003809388.1.31572 WP_003809388.1.31632 WP_003809388.1.32589 WP_003809388.1.33898 WP_003809388.1.37794 WP_003809388.1.38534 WP_003809388.1.40806 WP_003809388.1.42576 WP_003809388.1.43400 WP_003809388.1.43447 WP_003809388.1.47170 WP_003809388.1.50287 WP_003809388.1.54628 WP_003809388.1.56758 WP_003809388.1.56782 WP_003809388.1.5701 WP_003809388.1.57255 WP_003809388.1.63136 WP_003809388.1.63299 WP_003809388.1.63717 WP_003809388.1.63791 WP_003809388.1.64622 WP_003809388.1.65401 WP_003809388.1.66177 WP_003809388.1.67928 WP_003809388.1.69310 WP_003809388.1.69835 WP_003809388.1.71104 WP_003809388.1.71382 WP_003809388.1.71489 WP_003809388.1.72041 WP_003809388.1.72199 WP_003809388.1.72302 WP_003809388.1.77807 WP_003809388.1.78117 WP_003809388.1.82663 WP_003809388.1.84958 WP_003809388.1.84976 WP_003809388.1.86585 WP_003809388.1.86646 WP_003809388.1.87218 WP_003809388.1.88542 WP_003809388.1.91389 WP_003809388.1.93987 YP_006897312.1.34978 YP_006968170.1.84680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]