SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410474546|ref|YP_006897827.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410474546|ref|YP_006897827.1|
Domain Number 1 Region: 30-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.11e-17
Family GntR-like transcriptional regulators 0.01
Further Details:      
 
Domain Number 2 Region: 105-241
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000915
Family GntR ligand-binding domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410474546|ref|YP_006897827.1|
Sequence length 261
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MRYLCFNVYLVFSYICKLRRPAAKEFILDVKAPATIPYFLKEQIRELIVDGTFRPGQPLR
EQDLEQRFGTSRSPIREALRLLERGGLVVHLQRKGFRIRRYSQTEIRQVYMLYAELEAYS
IMQLSEAADLSPLLDDLRRHEARIAQAQADADVRGYIGALRDFYLASARFTGNVPLADTL
SRLYEQVEPLRYNLVRRTLAATPADQYHRGIVPALAQRDLAGAARQAHVLVREMLPRILS
AYEQWAGDAGDEPGDDRLRVA
Download sequence
Identical sequences A0A0C6PCI1 A0A0H3LR03 A0A2J9U5F3 K0MAY0 Q7W3L9
WP_003815149.1.101424 WP_003815149.1.15674 WP_003815149.1.1660 WP_003815149.1.17359 WP_003815149.1.19828 WP_003815149.1.20111 WP_003815149.1.21837 WP_003815149.1.22732 WP_003815149.1.23657 WP_003815149.1.23701 WP_003815149.1.24339 WP_003815149.1.26498 WP_003815149.1.27032 WP_003815149.1.29688 WP_003815149.1.30681 WP_003815149.1.31246 WP_003815149.1.31572 WP_003815149.1.31632 WP_003815149.1.32589 WP_003815149.1.33898 WP_003815149.1.37794 WP_003815149.1.38534 WP_003815149.1.40806 WP_003815149.1.42576 WP_003815149.1.43400 WP_003815149.1.47170 WP_003815149.1.54628 WP_003815149.1.56758 WP_003815149.1.56782 WP_003815149.1.5701 WP_003815149.1.57255 WP_003815149.1.58338 WP_003815149.1.63136 WP_003815149.1.63299 WP_003815149.1.63791 WP_003815149.1.64622 WP_003815149.1.65401 WP_003815149.1.66177 WP_003815149.1.67928 WP_003815149.1.69310 WP_003815149.1.69835 WP_003815149.1.71104 WP_003815149.1.71382 WP_003815149.1.71489 WP_003815149.1.72041 WP_003815149.1.72199 WP_003815149.1.72302 WP_003815149.1.77807 WP_003815149.1.78117 WP_003815149.1.82663 WP_003815149.1.84958 WP_003815149.1.84976 WP_003815149.1.86585 WP_003815149.1.86646 WP_003815149.1.87218 WP_003815149.1.88542 WP_003815149.1.91389 WP_003815149.1.93987 YP_006897827.1.34978 YP_006969972.1.84680 gi|410421935|ref|YP_006902384.1| gi|33603460|ref|NP_891020.1| gi|410474546|ref|YP_006897827.1| gi|412341217|ref|YP_006969972.1| gi|33598515|ref|NP_886158.1| 257310.BB4486 257311.BPP4013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]