SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410474729|ref|YP_006898010.1| from Bordetella parapertussis Bpp5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410474729|ref|YP_006898010.1|
Domain Number 1 Region: 107-242
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.45e-24
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 18-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.23e-22
Family GntR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410474729|ref|YP_006898010.1|
Sequence length 246
Comment GntR family transcriptional regulator [Bordetella parapertussis Bpp5]
Sequence
MIAHYNPRIFSCLAEPMEKVRRVSVVDEVVEQISQKILSGEWPPDTMLPSLRSFAASADV
SMMTVREAIRILQARGLLETRHGVGTFVLAPDRQHGTPWTLAVDDTEEYADLIEAREYIE
SAILDLAAQRVTREQLARLREITRAMRAARLDSGAFLAADEAFHLTLAEAAHNNTLQHMV
QALRGPMRRIMANRNLQQLKESGNLDSAIRDHEDIVAALAQRDKRKGLKALRTIIKRGKD
YLATLA
Download sequence
Identical sequences A0A0H3LRF3 K0MP37
257310.BB4685 gi|410474729|ref|YP_006898010.1| WP_010927168.1.15674 WP_010927168.1.1660 WP_010927168.1.17334 WP_010927168.1.19828 WP_010927168.1.29688 WP_010927168.1.32589 WP_010927168.1.38534 WP_010927168.1.40806 WP_010927168.1.50287 WP_010927168.1.58338 WP_010927168.1.63717 WP_010927168.1.64622 WP_010927168.1.66177 WP_010927168.1.69310 WP_010927168.1.71104 WP_010927168.1.72041 WP_010927168.1.82663 WP_010927168.1.84976 WP_010927168.1.86585 WP_010927168.1.87218 YP_006898010.1.34978 gi|33603657|ref|NP_891217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]