SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|522816232|ref|YP_008184461.1| from Alteromonas macleodii str. 'Ionian Sea UM4b'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|522816232|ref|YP_008184461.1|
Domain Number 1 Region: 10-370
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.85e-115
Family FMN-linked oxidoreductases 0.00000000232
Further Details:      
 
Domain Number 2 Region: 341-527
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 5.3e-40
Family N-terminal domain of adrenodoxin reductase-like 0.00000564
Further Details:      
 
Domain Number 3 Region: 478-638
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.32e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|522816232|ref|YP_008184461.1|
Sequence length 680
Comment 2,4-dienoyl-CoA reductase [Alteromonas macleodii str. 'Ionian Sea UM4b']
Sequence
MNQTVTDHPVYPHLFRPLDLGFTTLKNRVLMGSMHTGLEELPDGHKRMAAFYSERARGGV
GLIVTGGIGPNEEGATHPSTFRLDTDEAVKNHKEVTDAVHIAGGKICMQILHTGRYAYSP
KLVAPSAVQAPINPFKPKALEAEEIEKQVEDFITAATQAQRAGYDGVEIMGSEGYFLNQF
IAKRTNHRDDEWGGEYENRIRLPIEVVRRVREAVGKHFIIIYRLSMLDLVEGGSTYEEVV
QLGKEIEKAGATIINTGIGWHEARIPTIATKVPRAAFTWVTAKFREALSIPVITSNRINT
PEVAEEVLSRGDADMVSMARPFLADPDFVRKAQQNKADEINTCIGCNQACLDHVFNGKMT
SCLVNPRACHELEINVKPAETKKRVAVVGAGPAGLAAAVTSAQRGHDVVIYDASSEIGGQ
FNIAKQIPGKEEFYETLRYFKRQIELHKNITLKLNTYVDAAALNDEGFDEVMIATGIKPR
TPAIEGIEHEKVLTYIEVLKEKKPVGNKVAIIGAGGIGFDTAEYLSHGKETPSQDIPAFM
KEWGIDMTFSARAGIEGVKPQPEPSPREIFLLQRKTTKVGAGLGKTTGWAHRVGLLAKGV
TMIPGVSYDKIDDEGLHITVEGNSQVLPVDNIIICAGQEPMRDIVEGLNMPYHLIGGADE
ALELDAKRAIDQGTRVCAAV
Download sequence
Identical sequences S5BZT1
gi|410862192|ref|YP_006977426.1| gi|522614794|ref|YP_008180484.1| gi|522816232|ref|YP_008184461.1| WP_015067552.1.24997 WP_015067552.1.30323 WP_015067552.1.68468 WP_015067552.1.96561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]