SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|522815723|ref|YP_008183952.1| from Alteromonas macleodii str. 'Ionian Sea UM4b'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|522815723|ref|YP_008183952.1|
Domain Number 1 Region: 125-550
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.65e-86
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0045
Further Details:      
 
Domain Number 2 Region: 580-797
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.05e-52
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|522815723|ref|YP_008183952.1|
Sequence length 939
Comment 2-oxoglutarate dehydrogenase E1 component [Alteromonas macleodii str. 'Ionian Sea UM4b']
Sequence
MQESVMKAWWDSSHMAGANAAYVEELYETYLEDPQSVSENWRQIFDNLPKVDGVELETNH
TTIKNQFRQLAALGPTARMSSPSSPSANVSDDRQVKVLQLINAFRFRGHQHANLDPLGLW
QQERVRDLELSHHSLSDQDFDSVFNVGSYAIGKESMPLGELFKSLNRTYCGSIGAEYMHI
TDTEQKRWLQQKIESVQAKPEISRDEKLGILKGLTAADGMEKYLGSKFPGAKRFSLEGGD
ALIPMLKGLITKAGTAGTKEVVIGMAHRGRLNVLVNVLGKNPSVLFDEFSGKHDDSLGAG
DVKYHAGFSSDFATPGGNVHLALAFNPSHLEIVNPVVMGSVRARLARRDNDTNTVLPITI
HGDSAIAGQGVVQETFNMSQTRGFAVGGTVRIVVNNQVGFTTSKTEDTRSTQYCTDIAKM
VQAPIFHVNSDDPEAVAFVTQLALEYRNKFKKDVVIDLVCYRRHGHNEADEPNATQPLMY
QKIKKHPVPRVLYADQLIAEGVIEQRDADRYLEEYREALDHGACVVEEWRPMTEHSVDWS
PYLGHDWDTPYDGALSVEKLKELGESITTIPEDHKLQSRVNKLYQDRKAMVAGEKKLDWG
MAENLAYATIVDAGEDIRITGQDSGRGTFFHRHAVLHNQKDASTYMPLQHIREGQGEIEI
YDSVLSEEAVMAFEYGYATAEPTCLTIWEAQFGDFANGAQVVFDQFLSSGEAKWGRLCGL
TVLLPHGYEGQGPEHSSARLERFLQMCADHNWQVCVPSTPAQVYNMLRRQVVRPMRKPLI
VMSPKSLLRHPMAVSSLEELAEGKFHNVIDEIDDIDPKNVKRVVMCSGKVYYDLLDQRRK
NEQTDVAIIRLEQLYPFPQEECAKVVAQYSHVKDWVWCQEEPQNQGAWYCSQHHFWQAIP
DGAKLTYAGRDASSSPAVGYVSVHNQQQKALVENALTIK
Download sequence
Identical sequences S5C2M1
gi|522614291|ref|YP_008179981.1| WP_015067209.1.24997 WP_015067209.1.30323 WP_015067209.1.68468 WP_015067209.1.96561 gi|410861688|ref|YP_006976922.1| gi|522815723|ref|YP_008183952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]