SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|522817238|ref|YP_008185467.1| from Alteromonas macleodii str. 'Ionian Sea UM4b'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|522817238|ref|YP_008185467.1|
Domain Number 1 Region: 18-523
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.23e-100
Family Pyridoxal-dependent decarboxylase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|522817238|ref|YP_008185467.1|
Sequence length 544
Comment glutamate decarboxylase [Alteromonas macleodii str. 'Ionian Sea UM4b']
Sequence
MGEAQVSLEHLFRVFTKPEHKDSKLAQIEQHLSDNILDFLSQHVVTKKTSLEEIEKDFSD
SKVPESPEFVSTHAESLLDKLVAHSVNTYSPTFIGHMTSALPYFHLPLSKLMVGLNQNLV
KIETSKAFTPLERQVLGMMHNLVYDQPQRFYDNHLHSAAHSLGAFCSGGTIANITALWVA
RNKLLGPQDGFCGVAKAGLAAAYRHLDINNLGVMCSKRGHYSLSKAVDVLGLGRDQLLTI
PAPRQTLDPAKALRIGKRYQEEGNKLLAIVGVGGTTETGHVDPLDELADVANELGCWFHV
DAAWGGATLFSSRYRDRLKGIERADSVTIDAHKQMYVPMGAGMALFKDPQNANAVRHHAQ
YILRAGSKDLGATTLEGSRNGMAMMVYSALHIFGRKGYELLIDRSIDKAKDFSHMIDKAG
DFELTTTPTLSLLTYRVCPEEVQEKLKHADANMRNAINEKVDALVVAVQKQQREAGKSFV
SRTRLEAPDYPSQCITVFRVVLANPLTSHNDLAAILAEQHLIAKETQAWAELMNFVRDSE
KVAS
Download sequence
Identical sequences F2G682 S5AK16 S5C788
gi|332143074|ref|YP_004428812.1| gi|522651578|ref|YP_008194041.1| gi|522817238|ref|YP_008185467.1| gi|522591515|ref|YP_008177592.1| gi|522615891|ref|YP_008181581.1| gi|522669453|ref|YP_008197915.1| gi|566719980|ref|YP_008920302.1| WP_012519843.1.21115 WP_012519843.1.24997 WP_012519843.1.30323 WP_012519843.1.35093 WP_012519843.1.36926 WP_012519843.1.48123 WP_012519843.1.68468 WP_012519843.1.96561 314275.MADE_03552 gi|410863284|ref|YP_006978518.1| gi|522571071|ref|YP_008173500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]