SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525809543|ref|YP_008243019.1| from Streptococcus pyogenes HSC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525809543|ref|YP_008243019.1|
Domain Number 1 Region: 13-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.5e-56
Family Phosphate binding protein-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525809543|ref|YP_008243019.1|
Sequence length 299
Comment ABC transporter substrate-binding protein [Streptococcus pyogenes HSC5]
Sequence
MLYYSYLNKGVTMKKSVTLLSIGLASLLLAACAPHKSQKSSWETIKEKGVLKVATPGTYQ
PTSFYNDNNELVGYEVDMVKEIGKRLNIKVKFVETGFDQAFTSVDSGRVDISLNNFDITP
KRHKKYNISTPYKYGVGGMIVRADGSSNMAKKDLSDWKGKKAAGASGTEYMKVAQKQGAE
LVTYDNVTGDVYLNDVANGRTDFIPNDYPAQKLFVDYMLSQNPNLNVKMSDVQYNPTEQG
IVMNKKDDSLKKKIDAVIKDMIKDGSLKKISETYYAGQDLTKPFGKDKKIPVIDTKDVN
Download sequence
Identical sequences WP_020833425.1.13803 WP_020833425.1.40473 WP_020833425.1.51729 WP_020833425.1.58465 WP_020833425.1.60269 WP_020833425.1.65801 WP_020833425.1.69171 WP_020833425.1.94988 gi|525809543|ref|YP_008243019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]