SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525809603|ref|YP_008243088.1| from Streptococcus pyogenes HSC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525809603|ref|YP_008243088.1|
Domain Number 1 Region: 36-339
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.54e-58
Family Phosphate binding protein-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525809603|ref|YP_008243088.1|
Sequence length 348
Comment iron ABC transporter substrate-binding protein [Streptococcus pyogenes HSC5]
Sequence
MLKLKRKWLLSFLLVIIILAIVNIAMYIFSSSKKDSAKELVILTPNSQTILTGTIPAFEE
KYGVKVRLIQGGTGQLIDQLGRKDKPLNADIFFGGNYTQFESHKDLFESYVSPQVSTVIS
DYQLPSHRATPYTINGSVLIVNNELARGLHITSYEDLLQPALKGKIAFADPNSSSSAFSQ
LTNILLAKGGYTSSEAWEYVKRLLLSMNSIRATSSSDVYESVAEGKMIVGLTYEDPCINL
QKSGANVSIVYPDEGTVFVPSSVAIIKKAKAMKEAKQFINFILSSDVQNAFGQSTSNRPI
RRDAQTSHEMKPLDEIITLKEDYGYVTRHKKKILNTYNRLHEALERGK
Download sequence
Identical sequences A0A0E1EN40 A0A0H2UV24 A0A2J9PGX0 Q48TT0 Q5XCC2 U2VYY2
WP_011017728.1.11114 WP_011017728.1.12676 WP_011017728.1.13094 WP_011017728.1.13655 WP_011017728.1.1526 WP_011017728.1.16883 WP_011017728.1.17594 WP_011017728.1.17618 WP_011017728.1.19471 WP_011017728.1.20146 WP_011017728.1.21068 WP_011017728.1.22309 WP_011017728.1.22587 WP_011017728.1.23344 WP_011017728.1.23345 WP_011017728.1.23854 WP_011017728.1.24256 WP_011017728.1.24771 WP_011017728.1.24800 WP_011017728.1.25570 WP_011017728.1.26201 WP_011017728.1.2644 WP_011017728.1.26942 WP_011017728.1.27102 WP_011017728.1.30208 WP_011017728.1.30259 WP_011017728.1.30461 WP_011017728.1.31038 WP_011017728.1.31126 WP_011017728.1.32327 WP_011017728.1.32791 WP_011017728.1.34145 WP_011017728.1.34154 WP_011017728.1.35339 WP_011017728.1.3577 WP_011017728.1.35803 WP_011017728.1.3764 WP_011017728.1.38004 WP_011017728.1.40473 WP_011017728.1.40861 WP_011017728.1.41087 WP_011017728.1.42545 WP_011017728.1.45787 WP_011017728.1.47933 WP_011017728.1.49019 WP_011017728.1.49308 WP_011017728.1.51111 WP_011017728.1.51625 WP_011017728.1.52414 WP_011017728.1.5275 WP_011017728.1.52963 WP_011017728.1.53322 WP_011017728.1.53936 WP_011017728.1.55521 WP_011017728.1.56335 WP_011017728.1.57973 WP_011017728.1.58073 WP_011017728.1.58327 WP_011017728.1.59543 WP_011017728.1.60269 WP_011017728.1.60446 WP_011017728.1.61350 WP_011017728.1.62548 WP_011017728.1.62966 WP_011017728.1.6385 WP_011017728.1.64024 WP_011017728.1.64903 WP_011017728.1.65729 WP_011017728.1.6624 WP_011017728.1.66918 WP_011017728.1.67715 WP_011017728.1.67764 WP_011017728.1.68302 WP_011017728.1.68539 WP_011017728.1.69961 WP_011017728.1.71714 WP_011017728.1.72664 WP_011017728.1.7367 WP_011017728.1.74272 WP_011017728.1.74440 WP_011017728.1.74742 WP_011017728.1.74766 WP_011017728.1.75067 WP_011017728.1.77602 WP_011017728.1.7902 WP_011017728.1.80549 WP_011017728.1.81017 WP_011017728.1.81317 WP_011017728.1.81523 WP_011017728.1.8309 WP_011017728.1.84495 WP_011017728.1.84548 WP_011017728.1.86569 WP_011017728.1.87367 WP_011017728.1.87596 WP_011017728.1.87861 WP_011017728.1.8796 WP_011017728.1.88361 WP_011017728.1.89339 WP_011017728.1.89609 WP_011017728.1.9206 WP_011017728.1.92241 WP_011017728.1.92885 WP_011017728.1.93434 WP_011017728.1.94718 WP_011017728.1.95191 WP_011017728.1.95441 WP_011017728.1.97674 WP_011017728.1.99981 gi|19746035|ref|NP_607171.1| gi|50914152|ref|YP_060124.1| gi|71903428|ref|YP_280231.1| 186103.spyM18_1040 193567.SPs0948 198466.SpyM3_0747 286636.M6_Spy0806 319701.M28_Spy0763 gi|28895860|ref|NP_802210.1| gi|21910283|ref|NP_664551.1| gi|525809603|ref|YP_008243088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]