SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525809621|ref|YP_008243107.1| from Streptococcus pyogenes HSC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525809621|ref|YP_008243107.1|
Domain Number 1 Region: 36-353
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.98e-90
Family Phosphate binding protein-like 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525809621|ref|YP_008243107.1|
Sequence length 357
Comment spermidine/putrescine ABC transporter substrate-binding protein [Streptococcus pyogenes HSC5]
Sequence
MRKLYSFLAGVLGVIVILTSLSFILQKKSGSGSQSDKLVIYNWGDYIDPALLKKFTKETG
IEVQYETFDSNEAMYTKIKQGGTTYDIAVPSDYTIDKMIKENLLNKLDKSKLVGMDNIGK
EFLGKSFDPQNDYSLPYFWGTVGIVYNDQLVDKAPMHWEDLWRPEYKNSIMLIDGAREML
GVGLTTFGYSVNSKNLEQLQAAERKLQQLTPNVKAIVADEMKGYMIQGDAAIGITFSGEA
SEMLDSNEHLHYIVPSEGSNLWFDNLVLPKTMKHEKEAYAFLNFINRPENAAQNAAYIGY
ATPNKKAKALLPDEIKNDPAFYPTDDIIKKLEVYDNLGSRWLGIYNDLYLQFKMYRK
Download sequence
Identical sequences A0A0E1ESE9 A0A0H2UV35 A0A2H1X529 J7M1I6 Q1J6Q3 Q1JGY4 Q1JLT4 Q48TP1 Q5XCA1 Q99ZS5
gi|410680501|ref|YP_006932903.1| gi|94988578|ref|YP_596679.1| gi|386362650|ref|YP_006071981.1| gi|71903471|ref|YP_280274.1| gi|21910303|ref|NP_664571.1| NP_269262.1.14755 WP_002984738.1.100536 WP_002984738.1.100577 WP_002984738.1.100791 WP_002984738.1.100847 WP_002984738.1.100902 WP_002984738.1.101138 WP_002984738.1.101603 WP_002984738.1.101866 WP_002984738.1.102005 WP_002984738.1.1042 WP_002984738.1.11114 WP_002984738.1.11642 WP_002984738.1.11796 WP_002984738.1.1208 WP_002984738.1.12667 WP_002984738.1.12676 WP_002984738.1.13094 WP_002984738.1.134 WP_002984738.1.13499 WP_002984738.1.13655 WP_002984738.1.13702 WP_002984738.1.13723 WP_002984738.1.13803 WP_002984738.1.14556 WP_002984738.1.15156 WP_002984738.1.1526 WP_002984738.1.15301 WP_002984738.1.15867 WP_002984738.1.16107 WP_002984738.1.16883 WP_002984738.1.17594 WP_002984738.1.17618 WP_002984738.1.19034 WP_002984738.1.19566 WP_002984738.1.19969 WP_002984738.1.19971 WP_002984738.1.20187 WP_002984738.1.20282 WP_002984738.1.2074 WP_002984738.1.20768 WP_002984738.1.20957 WP_002984738.1.21068 WP_002984738.1.21420 WP_002984738.1.22005 WP_002984738.1.22309 WP_002984738.1.22587 WP_002984738.1.22610 WP_002984738.1.2271 WP_002984738.1.22927 WP_002984738.1.22931 WP_002984738.1.23344 WP_002984738.1.23366 WP_002984738.1.23784 WP_002984738.1.23854 WP_002984738.1.23879 WP_002984738.1.24800 WP_002984738.1.25549 WP_002984738.1.26201 WP_002984738.1.26216 WP_002984738.1.2644 WP_002984738.1.26529 WP_002984738.1.26775 WP_002984738.1.26802 WP_002984738.1.27012 WP_002984738.1.27102 WP_002984738.1.2743 WP_002984738.1.27781 WP_002984738.1.27947 WP_002984738.1.28087 WP_002984738.1.28592 WP_002984738.1.29494 WP_002984738.1.29586 WP_002984738.1.29629 WP_002984738.1.30259 WP_002984738.1.30461 WP_002984738.1.31038 WP_002984738.1.31126 WP_002984738.1.32327 WP_002984738.1.32791 WP_002984738.1.33081 WP_002984738.1.34145 WP_002984738.1.34147 WP_002984738.1.34154 WP_002984738.1.34661 WP_002984738.1.34964 WP_002984738.1.35136 WP_002984738.1.35416 WP_002984738.1.35765 WP_002984738.1.3577 WP_002984738.1.35803 WP_002984738.1.36083 WP_002984738.1.36559 WP_002984738.1.37580 WP_002984738.1.38426 WP_002984738.1.39740 WP_002984738.1.39774 WP_002984738.1.39950 WP_002984738.1.40253 WP_002984738.1.4028 WP_002984738.1.40473 WP_002984738.1.4053 WP_002984738.1.41087 WP_002984738.1.41304 WP_002984738.1.41398 WP_002984738.1.41814 WP_002984738.1.42026 WP_002984738.1.42545 WP_002984738.1.43805 WP_002984738.1.44357 WP_002984738.1.45044 WP_002984738.1.45784 WP_002984738.1.45887 WP_002984738.1.46237 WP_002984738.1.46364 WP_002984738.1.46419 WP_002984738.1.47538 WP_002984738.1.47933 WP_002984738.1.48446 WP_002984738.1.49195 WP_002984738.1.49289 WP_002984738.1.49308 WP_002984738.1.51065 WP_002984738.1.51270 WP_002984738.1.51625 WP_002984738.1.51729 WP_002984738.1.52458 WP_002984738.1.5255 WP_002984738.1.5275 WP_002984738.1.52963 WP_002984738.1.53322 WP_002984738.1.53400 WP_002984738.1.53936 WP_002984738.1.54255 WP_002984738.1.54994 WP_002984738.1.55020 WP_002984738.1.55040 WP_002984738.1.55521 WP_002984738.1.55942 WP_002984738.1.56127 WP_002984738.1.56455 WP_002984738.1.57070 WP_002984738.1.58073 WP_002984738.1.58327 WP_002984738.1.58465 WP_002984738.1.59139 WP_002984738.1.59543 WP_002984738.1.5959 WP_002984738.1.59712 WP_002984738.1.60269 WP_002984738.1.60378 WP_002984738.1.60429 WP_002984738.1.60435 WP_002984738.1.60446 WP_002984738.1.61127 WP_002984738.1.61350 WP_002984738.1.62548 WP_002984738.1.62966 WP_002984738.1.63074 WP_002984738.1.6385 WP_002984738.1.64314 WP_002984738.1.64903 WP_002984738.1.65209 WP_002984738.1.65801 WP_002984738.1.65831 WP_002984738.1.66918 WP_002984738.1.67715 WP_002984738.1.67764 WP_002984738.1.68080 WP_002984738.1.68191 WP_002984738.1.68302 WP_002984738.1.69171 WP_002984738.1.69206 WP_002984738.1.69338 WP_002984738.1.69536 WP_002984738.1.69602 WP_002984738.1.70332 WP_002984738.1.70768 WP_002984738.1.71085 WP_002984738.1.71274 WP_002984738.1.71714 WP_002984738.1.71931 WP_002984738.1.72175 WP_002984738.1.72435 WP_002984738.1.72664 WP_002984738.1.72799 WP_002984738.1.73416 WP_002984738.1.7367 WP_002984738.1.74272 WP_002984738.1.74388 WP_002984738.1.74440 WP_002984738.1.74742 WP_002984738.1.74766 WP_002984738.1.74769 WP_002984738.1.74773 WP_002984738.1.75067 WP_002984738.1.75380 WP_002984738.1.75397 WP_002984738.1.75746 WP_002984738.1.75979 WP_002984738.1.77086 WP_002984738.1.77451 WP_002984738.1.77464 WP_002984738.1.77602 WP_002984738.1.77721 WP_002984738.1.7902 WP_002984738.1.7969 WP_002984738.1.80116 WP_002984738.1.8063 WP_002984738.1.80675 WP_002984738.1.81017 WP_002984738.1.81227 WP_002984738.1.81317 WP_002984738.1.81515 WP_002984738.1.81523 WP_002984738.1.83533 WP_002984738.1.83949 WP_002984738.1.84495 WP_002984738.1.84548 WP_002984738.1.84888 WP_002984738.1.85790 WP_002984738.1.86460 WP_002984738.1.86569 WP_002984738.1.86840 WP_002984738.1.87115 WP_002984738.1.87245 WP_002984738.1.87367 WP_002984738.1.88255 WP_002984738.1.88297 WP_002984738.1.88525 WP_002984738.1.88809 WP_002984738.1.89339 WP_002984738.1.89421 WP_002984738.1.89609 WP_002984738.1.91031 WP_002984738.1.91222 WP_002984738.1.92241 WP_002984738.1.92885 WP_002984738.1.93188 WP_002984738.1.93335 WP_002984738.1.93434 WP_002984738.1.93887 WP_002984738.1.93979 WP_002984738.1.94658 WP_002984738.1.94718 WP_002984738.1.94743 WP_002984738.1.94792 WP_002984738.1.94988 WP_002984738.1.95191 WP_002984738.1.95441 WP_002984738.1.95717 WP_002984738.1.96175 WP_002984738.1.96338 WP_002984738.1.96528 WP_002984738.1.96685 WP_002984738.1.96787 WP_002984738.1.97076 WP_002984738.1.97674 WP_002984738.1.97748 WP_002984738.1.9843 WP_002984738.1.98562 WP_002984738.1.98938 WP_002984738.1.99282 WP_002984738.1.99582 WP_002984738.1.99639 WP_002984738.1.99902 WP_002984738.1.99981 gi|525809621|ref|YP_008243107.1| gi|71910642|ref|YP_282192.1| gi|94990454|ref|YP_598554.1| gi|50914173|ref|YP_060145.1| gi|94992400|ref|YP_600499.1| gi|15675088|ref|NP_269262.1| gi|94994376|ref|YP_602474.1| gi|28895879|ref|NP_802229.1| 160490.SPy_1105 193567.SPs0967 198466.SpyM3_0767 286636.M6_Spy0827 293653.M5005_Spy_0829 319701.M28_Spy0806 370551.MGAS9429_Spy0948 370552.MGAS10270_Spy0945 370553.MGAS2096_Spy0903 370554.MGAS10750_Spy0980 gi|470200983|ref|YP_007587412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]