SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383180265|ref|YP_005458270.1| from Shigella sonnei 53G

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383180265|ref|YP_005458270.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.05e-110
Family FMN-linked oxidoreductases 0.00000000000972
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.63e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383180265|ref|YP_005458270.1|
Sequence length 672
Comment NADPH dehydrogenase [Shigella sonnei 53G]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLNVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences WP_000121452.1.100851 WP_000121452.1.101313 WP_000121452.1.102021 WP_000121452.1.10222 WP_000121452.1.10715 WP_000121452.1.11673 WP_000121452.1.1176 WP_000121452.1.13891 WP_000121452.1.14958 WP_000121452.1.15245 WP_000121452.1.15252 WP_000121452.1.15762 WP_000121452.1.16482 WP_000121452.1.17389 WP_000121452.1.18675 WP_000121452.1.1903 WP_000121452.1.1915 WP_000121452.1.19602 WP_000121452.1.20178 WP_000121452.1.21277 WP_000121452.1.21578 WP_000121452.1.21637 WP_000121452.1.21895 WP_000121452.1.22571 WP_000121452.1.23914 WP_000121452.1.24799 WP_000121452.1.2537 WP_000121452.1.255 WP_000121452.1.25652 WP_000121452.1.2612 WP_000121452.1.26467 WP_000121452.1.26575 WP_000121452.1.28762 WP_000121452.1.29252 WP_000121452.1.30580 WP_000121452.1.3063 WP_000121452.1.31639 WP_000121452.1.31679 WP_000121452.1.32173 WP_000121452.1.32279 WP_000121452.1.32580 WP_000121452.1.32635 WP_000121452.1.32720 WP_000121452.1.33053 WP_000121452.1.3323 WP_000121452.1.33979 WP_000121452.1.34440 WP_000121452.1.34827 WP_000121452.1.35186 WP_000121452.1.35398 WP_000121452.1.36040 WP_000121452.1.37006 WP_000121452.1.37146 WP_000121452.1.39155 WP_000121452.1.39715 WP_000121452.1.42728 WP_000121452.1.4411 WP_000121452.1.44264 WP_000121452.1.44287 WP_000121452.1.4563 WP_000121452.1.47030 WP_000121452.1.49136 WP_000121452.1.49684 WP_000121452.1.50098 WP_000121452.1.50196 WP_000121452.1.5040 WP_000121452.1.5046 WP_000121452.1.50548 WP_000121452.1.50936 WP_000121452.1.51201 WP_000121452.1.51336 WP_000121452.1.52126 WP_000121452.1.52230 WP_000121452.1.52601 WP_000121452.1.53811 WP_000121452.1.53878 WP_000121452.1.55177 WP_000121452.1.56446 WP_000121452.1.56937 WP_000121452.1.57663 WP_000121452.1.57898 WP_000121452.1.58942 WP_000121452.1.60925 WP_000121452.1.6094 WP_000121452.1.60974 WP_000121452.1.61524 WP_000121452.1.61853 WP_000121452.1.6334 WP_000121452.1.63683 WP_000121452.1.64563 WP_000121452.1.64939 WP_000121452.1.65110 WP_000121452.1.65954 WP_000121452.1.67149 WP_000121452.1.68069 WP_000121452.1.68490 WP_000121452.1.70190 WP_000121452.1.70698 WP_000121452.1.71176 WP_000121452.1.72778 WP_000121452.1.72806 WP_000121452.1.72956 WP_000121452.1.74243 WP_000121452.1.7479 WP_000121452.1.74993 WP_000121452.1.75155 WP_000121452.1.76452 WP_000121452.1.775 WP_000121452.1.78097 WP_000121452.1.79092 WP_000121452.1.79869 WP_000121452.1.79944 WP_000121452.1.81688 WP_000121452.1.81819 WP_000121452.1.82780 WP_000121452.1.83051 WP_000121452.1.84518 WP_000121452.1.84675 WP_000121452.1.84916 WP_000121452.1.85546 WP_000121452.1.86280 WP_000121452.1.8635 WP_000121452.1.86935 WP_000121452.1.86975 WP_000121452.1.87177 WP_000121452.1.87339 WP_000121452.1.880 WP_000121452.1.88678 WP_000121452.1.88720 WP_000121452.1.89400 WP_000121452.1.89656 WP_000121452.1.90115 WP_000121452.1.90182 WP_000121452.1.91117 WP_000121452.1.91594 WP_000121452.1.93085 WP_000121452.1.949 WP_000121452.1.96484 WP_000121452.1.96989 WP_000121452.1.98668 WP_000121452.1.98976 gi|383180265|ref|YP_005458270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]