SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|528983950|ref|YP_008029267.1| from Achromobacter xylosoxidans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528983950|ref|YP_008029267.1|
Domain Number 1 Region: 127-277
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.96e-35
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0085
Further Details:      
 
Domain Number 2 Region: 63-112
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000941
Family AraC type transcriptional activator 0.0084
Further Details:      
 
Domain Number 3 Region: 11-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000202
Family AraC type transcriptional activator 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|528983950|ref|YP_008029267.1|
Sequence length 277
Comment AraC-family transcriptional regulator [Achromobacter xylosoxidans NH44784-1996]
Sequence
MKPQTRATYAHRLDPVLRWLASHPDADPDLYQLADLACLSPYHFHRVYRAVMGETVNATV
QRIRMHRAAVSLGSTGDSLRDVAQRAGYESDAAFNRAFGATFGIPPGRYRATRSRPFDPK
ELGMYPITIETFPGAVLAALPHHGSYQEIGPVFTRAFMLAASRGLARPEAIGFGVYFDDP
EQVPPAQLRSMAGVSVAPDAELGDELERFEIPAIRCAVLTYTGPYNEMDKPYNWMFSEWL
PASGMVPADFPMFEQYLNDPRSTPPAQLQTRICMPLK
Download sequence
Identical sequences A0A0D6FDN6
WP_006389506.1.1102 WP_006389506.1.2141 WP_006389506.1.21631 WP_006389506.1.21720 WP_006389506.1.24717 WP_006389506.1.26036 WP_006389506.1.29298 WP_006389506.1.30196 WP_006389506.1.37231 WP_006389506.1.47990 WP_006389506.1.50137 WP_006389506.1.56128 WP_006389506.1.5915 WP_006389506.1.59228 WP_006389506.1.6199 WP_006389506.1.65261 WP_006389506.1.70984 WP_006389506.1.72604 WP_006389506.1.73050 WP_006389506.1.73619 WP_006389506.1.80540 WP_006389506.1.83498 WP_006389506.1.87081 WP_006389506.1.90279 WP_006389506.1.90725 WP_006389506.1.92290 WP_006389506.1.92670 WP_006389506.1.93368 WP_006389506.1.93631 WP_006389506.1.9400 WP_006389506.1.9413 WP_006389506.1.96794 WP_006389506.1.99476 WP_006389506.1.99933 gi|568125154|ref|YP_008921801.1| gi|528983950|ref|YP_008029267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]