SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|528984850|ref|YP_008030167.1| from Achromobacter xylosoxidans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528984850|ref|YP_008030167.1|
Domain Number 1 Region: 14-198
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.88e-52
Family Methylesterase CheB, C-terminal domain 0.000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|528984850|ref|YP_008030167.1|
Sequence length 211
Comment CheB methylesterase [Achromobacter xylosoxidans NH44784-1996]
Sequence
MTAPTPDRGDAAGAWDVIVIGGSSGAIEVLNLLMPALPAGLRAAVIVLLHLPRDRRSLLV
DIFRDRCALPLCEAEDQQPIQPGHVYFAPPDYHLLVDRGPRLALSIGPLVHFSRPSIDVL
FQSAADGYGERLLGVLLSGANEDGAAGLAAIHAAGGRAVVQAPDTAAMRAMPDAALARID
APEVLAPAAIAALLSQLPAQQRPCPPTSTTP
Download sequence
Identical sequences A0A0M7FW89
WP_020926416.1.5915 WP_020926416.1.60257 WP_020926416.1.60839 gi|528984850|ref|YP_008030167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]