SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538357832|ref|YP_008499860.1| from Streptococcus anginosus C238

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538357832|ref|YP_008499860.1|
Domain Number 1 Region: 20-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-51
Family Extended AAA-ATPase domain 0.000000424
Further Details:      
 
Domain Number 2 Region: 257-328
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.27e-22
Family Helicase DNA-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|538357832|ref|YP_008499860.1|
Sequence length 332
Comment Holliday junction DNA helicase B [Streptococcus anginosus C238]
Sequence
MSRILDNELMGDEELVERTLRPQYLREYIGQDKVKNQLKIFIEAAKMRDEALDHTLLFGP
PGLGKTTMAFVIANELGVNLKQTSGPVIEKAGDLVAILNDLEPGDVLFIDEIHRLPMSVE
EVLYSAMEDFYIDIMIGSGETSRSVHLDLPPFTLIGATTRAGMLSNPLRARFGITGHMEY
YAEADLTEIVERTAEIFEMDITHEAAEELALRSRGTPRIANRLLKRVRDFAQIMGDGLID
DQITDQALTMLDVDQEGLDYVDQKILKTMIEVYGGGPVGLGTLSVNIAEEQETVEDMYEP
YLIQKGFVMRTRTGRVATRKAYEHLGYEYLEK
Download sequence
Identical sequences I0SC30
WP_003036959.1.16089 WP_003036959.1.5353 WP_003036959.1.79605 gi|538357832|ref|YP_008499860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]