SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538359235|ref|YP_008501263.1| from Streptococcus anginosus C238

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538359235|ref|YP_008501263.1|
Domain Number 1 Region: 127-320
Classification Level Classification E-value
Superfamily ITPase-like 2.54e-64
Family ITPase (Ham1) 0.00000999
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|538359235|ref|YP_008501263.1|
Sequence length 328
Comment non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family [Streptococcus anginosus C238]
Sequence
MSSKIYEYKDTQDWYVGEWSPYGGGFYFKDVVSEELSRMEEGLRQLVVEEQSFSVAVIQY
NSIMSFVQFVLQMINENQDSQFQAQFHKGAILITEKGQLVLVHLPKNGIQLNDFFSQKNL
SGLTVGDTILVATRNEGKTAEFRKIFEKLGYKIENLNDYPDLPEVAETGMTFEENARLKA
ETISKLTGKMVLADDSGLKVDALGGLPGVWSARFAGNDATDLENNAKLLHELAMVFDLKD
RSAQFHTTLVVASPDKESLVVEADWPGYINFEPKGENGFGYDPLFLVGETGKTSAELTME
EKNAQSHRAQAVQKLVEVFPTWQNKPSS
Download sequence
Identical sequences A0A0E9EW15 I0S5Y0
gi|538359235|ref|YP_008501263.1| WP_003038538.1.16089 WP_003038538.1.5353 WP_003038538.1.79605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]