SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384894728|ref|YP_005768777.1| from Helicobacter pylori Sat464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384894728|ref|YP_005768777.1|
Domain Number 1 Region: 7-226
Classification Level Classification E-value
Superfamily Ribosomal protein L1 2.88e-82
Family Ribosomal protein L1 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384894728|ref|YP_005768777.1|
Sequence length 234
Comment 50S ribosomal protein L1 [Helicobacter pylori Sat464]
Sequence
MAKKVFKRLEKLFSKIQNDKAYGVEQGVEVVKSLASAKFDETVEVALRLGVDPRHADQMV
RGAVVLPHGTGKKVRVAVFAKDIKQDEAKNAGADVVGGDDLAEEIKNGRIDFDMVIATPD
MMAVVGKVGRILGPKGLMPNPKTGTVTMDIAKAVSNAKSGQVNFRVDKKGNVHAPIGKAS
FPEEKIKENMLELVKTINRLKPSSAKGKYIRNAALSLTMSPSVNLDAQELMDIK
Download sequence
Identical sequences A0A060PSK4 A0A0J8JU31 B9XVK4 D0ITP6 E6NF24 E6NHN7 E6NSX0 E6S3J4 G2MAK9 H8H6A0 J0IF29 J0LVT2 M4ZLE8 T0DQU2 T0E267 T0F559 T5CD06 T5CIW9 T5D161 T5D3A5 T5D9Y0 U4RDZ0 X2IKZ2
gi|385217896|ref|YP_005779372.1| gi|384894728|ref|YP_005768777.1| gi|384896473|ref|YP_005770462.1| gi|383750240|ref|YP_005425343.1| gi|385249657|ref|YP_005777876.1| gi|387782764|ref|YP_005793477.1| gi|386754661|ref|YP_006227879.1| WP_001085838.1.101183 WP_001085838.1.10816 WP_001085838.1.11291 WP_001085838.1.12789 WP_001085838.1.14390 WP_001085838.1.14978 WP_001085838.1.17554 WP_001085838.1.17727 WP_001085838.1.17944 WP_001085838.1.22342 WP_001085838.1.2421 WP_001085838.1.27651 WP_001085838.1.28017 WP_001085838.1.29538 WP_001085838.1.30111 WP_001085838.1.30584 WP_001085838.1.31461 WP_001085838.1.34076 WP_001085838.1.34093 WP_001085838.1.34585 WP_001085838.1.36873 WP_001085838.1.38251 WP_001085838.1.38596 WP_001085838.1.4068 WP_001085838.1.4107 WP_001085838.1.41887 WP_001085838.1.42181 WP_001085838.1.42363 WP_001085838.1.43167 WP_001085838.1.43568 WP_001085838.1.45280 WP_001085838.1.45656 WP_001085838.1.4744 WP_001085838.1.48677 WP_001085838.1.50394 WP_001085838.1.50724 WP_001085838.1.51398 WP_001085838.1.54635 WP_001085838.1.5507 WP_001085838.1.55553 WP_001085838.1.56576 WP_001085838.1.56977 WP_001085838.1.58284 WP_001085838.1.58846 WP_001085838.1.61260 WP_001085838.1.61432 WP_001085838.1.63638 WP_001085838.1.66440 WP_001085838.1.69108 WP_001085838.1.69927 WP_001085838.1.7116 WP_001085838.1.71427 WP_001085838.1.72129 WP_001085838.1.72196 WP_001085838.1.72479 WP_001085838.1.75207 WP_001085838.1.75871 WP_001085838.1.76465 WP_001085838.1.78606 WP_001085838.1.79844 WP_001085838.1.81207 WP_001085838.1.8250 WP_001085838.1.82517 WP_001085838.1.84964 WP_001085838.1.85073 WP_001085838.1.85460 WP_001085838.1.87302 WP_001085838.1.91593 WP_001085838.1.92641 WP_001085838.1.93359 WP_001085838.1.93523 WP_001085838.1.94217 WP_001085838.1.95311 WP_001085838.1.95857 WP_001085838.1.97097 WP_001085838.1.97956 WP_001085838.1.99076 gi|385230496|ref|YP_005790412.1| gi|470165557|ref|YP_007537271.1| gi|384898559|ref|YP_005773938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]