SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI01G23190.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G23190.1
Domain Number 1 Region: 260-324
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000569
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI01G23190.1
Sequence length 365
Comment pep:novel chromosome:ALNW00000000:1:25378331:25379428:-1 gene:OMERI01G23190 transcript:OMERI01G23190.1 description:""
Sequence
MPPAAAGYSAGMKRPLAAVAPSCDVDGGNAAAAAAAKRRERRREAKRARAAAAAAGALVP
YVAPIDARPIRAVPLAAAAAPRKEADDQAAAAPPAEPAWIRKILLERLGLTYDQPVVFIA
RKTVTRTDLDPHQNRFRLPIFGVERRLLPMLTLDEAKEANLVENDEEKGVPRPRPRPKKK
RRTEKGRVVAADGELQKPQGTTPETNVEGEDQAPPRPKPVPKKKKRRTEKGSVDVADGEQ
QQQQQEATVKEPRKKAQGKDHGGVPVTVLHLSGAMRELRLVLWDSSHGTIIKGTGYMDFI
AGTGLREHDAVQIWAFKRRGFRLFGATVPESRFYLVIVGGSWRPLEASPPLCMLPPSHAP
VEVCA
Download sequence
Identical sequences A0A0E0C5Z2
OMERI01G23190.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]