SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI01G25530.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G25530.1
Domain Number 1 Region: 179-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.43e-17
Family B3 DNA binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  OMERI01G25530.1
Domain Number - Region: 90-101
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0204
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G25530.1
Sequence length 401
Comment pep:novel chromosome:ALNW00000000:1:27526455:27531891:1 gene:OMERI01G25530 transcript:OMERI01G25530.1 description:""
Sequence
MRGEERWQEQPALASHPSRATLRPRGWPRLGLAPTGVGSSCPPAPASELARHLARRAPVS
ASPPVLPPIKDQGARPPTLAASAAAASSPPPPPPPIPPLPPSTSTSAARPTDMAGVTSKR
RSSSASTSSSSGDGAAVSDRPRGVTRKRRSGGRCPRPAASLRPAAPRPSSHHTAGLRVIL
QKELRYSDVSQLGRIVLPKKEAEAYLPILTSKDGKKSLCMHDLQNAQLWTFKYRYWPNNK
SRMYVLENTGDYVRTHDLQLGDSIVIYKDDENNRFVIGAKKAGDQQAATVPQVDEHISTL
FPIFPIAQVDDYLSPMAPQVDISAFVPHADENHEIFDGILNSLPEIPVANVRYSDFFDPF
DDGMDMANTLNANANQSASLHVTDDKSGHSLIPNPKSGPHM
Download sequence
Identical sequences A0A0E0C6Y3
OMERI01G25530.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]