SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI01G28620.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G28620.1
Domain Number 1 Region: 313-416
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-18
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 73-231
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000345
Family Tetramerization domain of potassium channels 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G28620.1
Sequence length 596
Comment pep:novel chromosome:ALNW00000000:1:30176152:30180097:1 gene:OMERI01G28620 transcript:OMERI01G28620.1 description:""
Sequence
MPAHSAVVVVAMEPSSSITIASSSSYLSNGSSPCSVALAPPGAVAAQAAPVAAGEGGGGG
GGGGGSSSVEVVSLNRLSANLERLLLDSDLDCSDADVDVADGGPPVPVHRCILAARSTFF
YNLFAARGRGGDGAAGGGGGGGERTGGRPRYKMEELVPGGRVGRDAFLSLLGYLYTGKLR
PAPHDVVSCADPVCPHDSCPPAIRFVVELMYAAWTFKITELISLFQRRLLNFVDKTVVED
VLPILQVAFHSELTPVLEKCVRRIARSNLDNVSFDKELPPEVAVQIKEIRQKSQPNEDDT
VISDPVHEKRVRRIHRALDSDDVELVKLLLNESEITLDDANALHYAAAYCDSKVVSELLD
LRLANLNLKNSRGYTALHLAAMRREPAIIMCLLNKGAAVSQLTADGQSAISICRRLTRLK
DYNTKMEQGQESNKDRLCIDILDREMIRNPMAVEDSVTSPLLADDLHMKLLYLENRVAFA
RLFFPAEAKVAMQIAQADTTPEFGGVPAASTSGKLKEVDLNETPVTQNKRLRSRVDALMK
TVELGRRYFPNCSQVLDKFLEDDLPDCPDVLYLQNGTSDEQNVKRMRMAVMIKSFQ
Download sequence
Identical sequences OMERI01G28620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]