SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI01G38270.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G38270.1
Domain Number 1 Region: 16-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000186
Family B3 DNA binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G38270.1
Sequence length 129
Comment pep:novel chromosome:ALNW00000000:1:38570435:38571108:1 gene:OMERI01G38270 transcript:OMERI01G38270.1 description:""
Sequence
MPGDHAGAAAAKATQLKVLMPSSFHKMRISDELAAHLLGDGDGGGGGATRRAARVVSPVG
KVWDVEVGRDDDGDDGAFLGRGWAEFAAAHGLGVGWFVVVRHEGGGVLTVKLFDTTCCLR
DFATRPAEI
Download sequence
Identical sequences OMERI01G38270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]