SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI02G04130.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI02G04130.1
Domain Number 1 Region: 137-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.2e-41
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 934-995
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000343
Family PB1 domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI02G04130.1
Sequence length 1049
Comment pep:novel chromosome:ALNW00000000:2:3310892:3317531:-1 gene:OMERI02G04130 transcript:OMERI02G04130.1 description:""
Sequence
MASMKQQQTPASSAVTAAAASSSAATAAVAACEGERKAAAINSELWHACAGPLVSLPPVG
SLVVYFPQGHSEQVAASMQKDVDAHVPSYPNLPSKLICLLHGVNLHADPDTDEVYAQMTL
QPVNTYGKEALQLSELALKQARPQMEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFS
MQPPAQELQARDIHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVIVVRDEKH
QLLLGIRRANRQPTNISSSVLSSDSMHIGVLAAAAHAAANSSPFTIFYNPRASPTEFVIP
FAKYQKALYSNQISLGMRFRMMFETEELGTRRYMGTITGISDLDPVRWKNSQWRNLQVGW
DESAAGERRNRVSIWEIEPVAAPFFLCPQPFFGVKRPRQLDDESEMENLFKRAMPWLGEE
VCIKDTQNQNGTAPGLSLVQWMNMNRQQSSSLANTAAQSEYLQALGNPAMQNLAADELAR
QLYVQNNLLQQNCIQFNSPKLPQQMQTMNDLSKAAIPLNPLGAIINPQDQKQDAVNHQRQ
QNSIQVIPLSQAQSNLVQAQKLQQQSLMSQSTSTLSQPPLIQEQQKLIMDMQKQLSNSHS
LAQQQMMPQQEIKPSLQATPLLPTVQQEQQQKLLQKQVSLADVSGVAFQPISSTNVIPKT
GGAMIISGATQSVVTEEMPSCSTSPSTANGNHLAQSTKNRHCINTERLPPSTAPMLIPTS
IDAVTATPLMTKELPKLNNSVKQSVVNSKLPNVAPGPQNCMNNALQTDNLETSSSATSLC
PSRTDGLAHQGFPSSNFNQHQMFKDALPDVEIEGVDPSNSGLFGINNDNPLGFPIETEDL
LINALDSVKYQNHISTDVENNYPMQKDALQEISTSMVSQSFGQSDMAFNSIDSAINDGAF
LNKNSWPAAPPLQRMRTFTKVYKRGAVGRSIDIGRYSGYEELKHALARMFGIEGQLEDRQ
RIGWKLVYKDHEDDILLLGDDPWEEFVNCVRCIRILSPQEVQQMSLDGDLGSNVLPNQAC
SSSDGVNGWRPRCDQNPGNPSIGPYDQFE
Download sequence
Identical sequences OMERI02G04130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]