SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI02G08420.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI02G08420.2
Domain Number 1 Region: 110-181
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000667
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 12-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000922
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI02G08420.2
Sequence length 233
Comment pep:novel chromosome:ALNW00000000:2:7105178:7106352:-1 gene:OMERI02G08420 transcript:OMERI02G08420.2 description:""
Sequence
MEEQMSNLRLANFKFFTIIQPGSFRTKLKLPDEFARELEAEERELRDAKLLVAGAGRRRR
DRMWDVKVVADGGVYLGRGWLRFARAHGLRDGDLLVFRYDGAAAFTVTNVPVEFQEAHGY
AAREKVVLRMRGRSWTVRLKHTKGRRPRRERTVLRYGWHRFCADNGLAVGDTCFFRALRS
GAGDVDDDGDGDHVLSVTVHKADGGNSLEGSIIHRFASISSFVACALITFKSM
Download sequence
Identical sequences OMERI02G08420.1 OMERI02G08420.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]