SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI02G11230.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI02G11230.2
Domain Number 1 Region: 259-452
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.84e-42
Family cAMP-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 51-255
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-40
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI02G11230.2
Sequence length 676
Comment pep:novel chromosome:ALNW00000000:2:10070261:10074249:-1 gene:OMERI02G11230 transcript:OMERI02G11230.2 description:""
Sequence
MTQAHSKSCFHQFWDGLQIKRSSDSFAVELLPSLGATINHSNKLQKFIISPYDPRYRSWE
LFLIVLVVYSAWICPFELAFLRDLPSKLLLVENIVDIFFAIDIVLTFFVAYVDSKTHLLV
DDRKRIAMRYLSTWFIFDVCSTAPFQPIILLFTHKGNDIAFKVLNLLRLWRLHRVSSLFA
RLEKDIRFNYFWTRSESLWTRYITALYWSITTLTTTGYGDLHAENPTEMLFDIVYMMFNL
GLTAYLIGNMTNLVVHGTSRTRKFRDSIQAASEFAARNQLPENIKQQVLSHFCLQFKTEG
LNQQVMLDCLPKGIRSSIAYSLFFPIIRQAYLFNGVSDNFIAELVMEVQAEYFPPKEDII
LQNEGEADVYIVVSGAVNIITTIHGNEQVYEKIAEGEMFGEVGALCNIPQPFTCRTAELS
QLLRISKTRLREIIEENREDSNILTNNLVQKLKLRESLPDMNQPDRRFLSKYELFHVPRE
AWLLKKSQLHYTEHTSRGSSNNTPVFGGDRYSRQLLGEATRSSASENENSGMTDKEENHD
EVHTNCETKKRTEEHCIQINSEDSSSTYSQQTMNATVQTGSPHKTEENITRRIPDEYYIK
EANKRVTIHKYRHNSTVSAAQNGKLIKLPTSLEELFKIGSQKFQGFHPRKVVSRDYAEID
DVSVIRDGDHLFLLEM
Download sequence
Identical sequences OMERI02G11230.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]