SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI02G19450.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI02G19450.1
Domain Number 1 Region: 119-259
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-44
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 552-629
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000491
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI02G19450.1
Sequence length 680
Comment pep:novel chromosome:ALNW00000000:2:22580588:22590552:1 gene:OMERI02G19450 transcript:OMERI02G19450.1 description:""
Sequence
MAGSVAAAAAAAASGGGTGSSCDALYRELWHACAGPLVTVPRQGELVYYFPQGHMEQLEA
STDQQLDQHLPLFNLPSKILCKVVNVELRAETDSDEVYAQIMLQPEADQNELTSPKPEPH
EPEKCNVHSFCKTLTASDTSTHGGFSVLRRHAEECLPPLDMTQNPPWQELVARDLHGNEW
HFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGENGELRVGVRRLMRQLNNMPS
SVISSHSMHLGVLATASHAISTGTLFSVFYKPRTSQSEFVVSANKYLEAKNSKISVGMRF
KMRFEGDEAPERRFSGTIIGVGSMSTSPWANSDWRSLKVQWDEPSVVPRPDRVSPWELEP
LAASNSQSSPQPPARNKRARPPASNSIAPELPPVFGLWKSSAESTQGFSFSGLQRTQELY
PSSPNLIFSTSLNVGFSTKNEPSALSNKHFYWPMRETRADSYSASISKVPSEKKQEPSSA
GCRLFGIEISSAVEATSPLAAVSGVGQDQPAASVDAESDQLSQPSHANKSDAPAASSEPS
PHETQSRQVRSCTKVIMQGMAVGRAVDLTRLHGYDDLRCKLEEMFDIQGELSASLKKWKV
VYTDDEDDMMLVGDDPWPEFCSMVKRIYIYTYEEAKQLTPKLKLPIIGDAIKPNPNKQSP
ESDMPHSDLDSTAPVTDKDC
Download sequence
Identical sequences A0A0E0CM01
OMERI02G19450.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]