SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI02G20180.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI02G20180.1
Domain Number 1 Region: 209-504
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.88e-98
Family Cryptochrome/photolyase FAD-binding domain 0.0000000001
Further Details:      
 
Domain Number 2 Region: 20-195
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 4.45e-51
Family Cryptochrome/photolyase, N-terminal domain 0.000000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI02G20180.1
Sequence length 712
Comment pep:novel chromosome:ALNW00000000:2:23382879:23387554:1 gene:OMERI02G20180 transcript:OMERI02G20180.1 description:""
Sequence
MSASPSSMSGAGAGEAGVRTVVWFRRDLRVEDNPALAAAARAAGEVVPVYVWAPEEDGPY
YPGRVSRWWLSQSLKHLDASLRRLGASRLVTRRSADAVVALIELVRSIGATHLFFNHLYD
PLSLVRDHRVKALLTAEGIAVQSFNADLLYEPWEVVDDDGCPFTMFAPFWDRCLCMPDPA
APLLPPKRIAPGELPARRCPSDELVFEDESERGSNALLARAWSPGWQNADKALAAFLNGP
LMDYSVNRKKADSASTSLLSPYLHFGELSVRKVFHQVRMKQLMWSNEGNHAGDESCVLFL
RSIGLREYSRYLTFNHPCSLEKPLLAHLRFFPWVVDEVYFKVWRQGRTGYPLVDAGMREL
WATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYISGSLPDGR
ELDRIDNPQLEGYKFDPHGEYVRRWLPELARLPTEWIHHPWDAPESVLQAAGIELGSNYP
LPIVELDAAKTRLQDALSEMWELEAASRAAMENGMEEGLGDSSDVPPIAFPAELQMEVDR
APAQPTVHGPTTAGRRREDQMVPSMTSSLIRAETELSADFDNNSMDSRPEVPSQVLFQPR
MEREETVDGIGGGGMAGRSNGGDHQGQHQQQQQHNFQTTIHRARGVAPSTSEASSNWTGR
EGGVVPVWSPPAASGPSDHYAADEADITSRSYLDRHPQSHTLMNWSQLSQSL
Download sequence
Identical sequences A0A0E0CMA9
OMERI02G20180.1 OMERI02G20180.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]