SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI02G21550.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI02G21550.1
Domain Number 1 Region: 327-419
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-16
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI02G21550.1
Sequence length 948
Comment pep:novel chromosome:ALNW00000000:2:24792574:24797450:-1 gene:OMERI02G21550 transcript:OMERI02G21550.1 description:""
Sequence
MKKKNRNCSDDMRNGDDEEKKKYSHHDMKKNLRNDANEEKRKSSDDMRDGGDKEKKKKCS
RQDMKKNLRNDADEEKRKSSDDMRDGDDEEKKKCSRHDMKKNSRNDADEEKRKRKRKCSD
DLKKSVLNDASKEATSHSDWRKNRKAGSDAEQRGKKLLNGDKKAKSRKVPTPFFEKLRKL
QMQRMSSQNGEKKMKSDGDSYKKTVPLSVNKGKMEKDGTNKRTLSNTLVAKERKMRPSDS
MEMKMKKKKRDASFVQPNERTAQTFSTKNKEKKRKSPSTPLKREQKERVASSDNKKETKK
ACIVAIGNEKKKCRDGKKKKRKAAFAFFKFVCDEFEELLFIPPAVAPSLKDLIDRHVYLE
DSEGKCSKIRLSVVDGSLAFYEGWNSFVSEHCIKWGEFLLFEYTPESTFSVRVFGMDSCE
RLHFSVKSGGKGAVKKRKERHTLSDDLISHYNGQYQDSEDIHDGPNVSGESPRSKEPKIT
VDAEIGTRNLVAKSINAASETQDSERVESGIGYGSLGALGDKVRNLSNGECDTRSDSVFC
IQEKTRRSEVIIISDEAYSTQVDEDTMKQTAPSEASEIHHVTINTQNDLERVVDGVCCES
SVALNNKMGNLILGEPKNKNISPACSTEKTNGSEITPTTGAIPLTQENIDTVKLNTFSCL
EEDRSTTRESELAAAIPTTSETHDSDKDLGQKHQMNSVQVNSIIAVDKNPNDSEMNISGN
IFRIYEAPAGTRCLEKWKKGIVNSRAALDDIGRVRPEKTQKTGEKLVGNCGAMGESPVDL
RIDSDVTDTCLKPILNIPIEELSILDSVSISKCGHSRTEVNHLFNQKGATVQLQTKKEPL
KPTSSSGNRKGDKIAVSVNRVFANQSEIQTPQQENGNFTSCVTPVALLPAKAELLDLDDH
SLQFCIPSTIQKWLVFSYSVVQWMQFVEFMLMPVRAATVKDTPLLISQ
Download sequence
Identical sequences OMERI02G21550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]