SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI02G23300.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI02G23300.1
Domain Number 1 Region: 202-460
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 7.06e-88
Family Cryptochrome/photolyase FAD-binding domain 0.00000000701
Further Details:      
 
Domain Number 2 Region: 7-178
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.05e-49
Family Cryptochrome/photolyase, N-terminal domain 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI02G23300.1
Sequence length 619
Comment pep:novel chromosome:ALNW00000000:2:26351374:26358259:1 gene:OMERI02G23300 transcript:OMERI02G23300.1 description:""
Sequence
MAGSERTVVWFRRDLRIDDNPALAAAARDGAVLPVFIWCPADEGQFYPGRCSRWWLKQSL
PHLSQSLESLGCPLVLIRAESTLEALLRCIDSVGATRLVYNHLYDPVSLVRDDKIRKELS
ALGISIQSFNGDLLYEPWEIYDDSGLAFTTFNMYWEKCMELPIDISPSLAPWKLVPVPGL
ESVRSCSVDDLGLESSKDEESSNALLRRAWSPGWRNAEKMLEEFVSHGLLEYSKHGMKVE
GATTSLLSPYLHFGEVSVRKVYQLVRMQQIKWENEGTSEAEESIHFFMRSIDEERFKSWR
QGMTGYPLVDAGMRELWATGWTHNRIRVIISSFAVKFLLIPWTWGMKYFWDVLLDADLES
DILGWQYISGSLPDGHELSRLDNPEVQGQKYDPDGVYVRTWIPELARMPTEWIHHPWDAP
SCILEVAGVELGFNYPKPIVELHIARECLDDAISTMWQLDTAEKLAELDGEVVEDNLSNI
KTFDIPKVVLRETSPCALPIDQRVPHASSNDHNLKSKVLKASNRSSICVDMIRSSKMEAT
SSVANSPVSRKRSYCETAFHVPSYSSSAEVHSHIQDHGGSLVGPSRYLLQEAGRNCVDEV
EDSSTADSGSSISRQRKAA
Download sequence
Identical sequences OMERI02G23300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]