SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI03G14370.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI03G14370.1
Domain Number 1 Region: 112-201,342-390,418-478
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 9.02e-25
Family Calcium ATPase, transmembrane domain M 0.027
Further Details:      
 
Domain Number 2 Region: 197-268,300-338
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.06e-17
Family Calcium ATPase, transduction domain A 0.0064
Further Details:      
 
Domain Number 3 Region: 471-507
Classification Level Classification E-value
Superfamily HAD-like 0.0000197
Family Meta-cation ATPase, catalytic domain P 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI03G14370.1
Sequence length 658
Comment pep:novel chromosome:ALNW00000000:3:12610588:12613694:-1 gene:OMERI03G14370 transcript:OMERI03G14370.1 description:""
Sequence
MDVVPARLPDPVPSPILRHSPSTSRSLRSVGDMPSVTFAGDMRSGSCRAESTASSFESFR
RAGSRPQPVGAVARMPTKRSASERAGSQRDLRDEDARFVYVNDAARTNAPPAKFPDNSVT
TTKYSVLTFIPRNLYEQFHRVAYVYFLILAALNQVPQLGVFSPVASVLPLAFVLGVTAVK
DAYEDWRRHRSDKTENNRTASVLVDGVFQPKPWREIQVGELVRVVANETLPCDMVLVSTS
DPTGVAYVQTINLDGESNLKTRYAKQETMSTPPEALAGLIKCEKPNRNIYGFLATVDLDG
RRAVSLGTSNIMLRGCELKNTAWAIGVAVYTGRDTKVMLNNSGAPSKRSRLETHTNRETI
VLAVVLTLLCTLVSLLAGIWLSDHSDELGVIPYFRKKDFSNPNEVERYKWYGTGAQVVFT
FMMAVIQFQVMIPIALFISMELVRVGQAYFMVQDEHMFDDKRQAKFQCRALNINEDLGQI
KYVFSDKTGTLTENRMEFRCASVHGGDFSETDGGDADGHAVAADGVVLRPKTAVKTDPKL
MAMLKHGTGAKADAARDFFLTLVTCNTIVPIIVDDDEDNDDPAAAAAKLVEYQGESPDEQ
ALVYAAAAYGYTLVERTSGHIIIDVFGTRQRIIMGHLGFSMIAGTNESVRQGQSNRSG
Download sequence
Identical sequences OMERI03G14370.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]