SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI03G23110.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI03G23110.1
Domain Number 1 Region: 284-377
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-24
Family B3 DNA binding domain 0.0066
Further Details:      
 
Domain Number 2 Region: 604-704
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-21
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 3 Region: 66-165
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-20
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 4 Region: 807-906
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.75e-18
Family B3 DNA binding domain 0.0082
Further Details:      
 
Domain Number 5 Region: 1016-1115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-18
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 6 Region: 451-545
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.12e-16
Family B3 DNA binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI03G23110.1
Sequence length 1118
Comment pep:novel chromosome:ALNW00000000:3:24510867:24530046:1 gene:OMERI03G23110 transcript:OMERI03G23110.1 description:""
Sequence
MAPPRKATSGAVGGGRSFLAAQEGAETGLTELARPRGRFTRMAGQGSQKKKSCDWPKRYV
DHLNGKMKCFHLQMSANFGHSMTIPNKFLDHFGGTLSRTIELESPKGVVYIVKVTKHMNE
TILQCGWEAFVDAHHIEENDSLLFHHIENSRFEVLILDSDGCEKVFTCAGIKRTSSVQER
NAAPVDISRSTHDETTQSSGSKKIVRCQKASSDSQRGKTAKLAETSSSGESGEEGTDSST
SEDESSYELDDPKMSPGHNYVLSHWTSLSEAQEEKVDMLVQDIQPEIPVFVAIMKHSNVN
SRRACLVIPKRYASAHFPHESQTITLQRQGKNKKWYPMFYIRKDGSGYMLYGCWKNFVRD
NHVKEGDMCIFHLTKFTGGEFGATVHLLRETKSGSLGSFHTSHKRFDLRDGRTRPKVTDA
RRVSSRPYLTADRVSLTEEQVRKVEEVVHSIQSEGPMYVSIMNKSNVGTDGLYIIIFGRQ
FATRYLPEGEQTLTLLMPGKSNAWQVKMRPRSGDAQMITTGWRHFVHDNRLQIEDICLFQ
LMNDERASLGLGKLGTHQASSSTSRPEKRNCCSGKSPFKTTIPNPEMKKYCDCCKRYVDH
SNGKMKCFHRQMSANFEHSMIIPNKFLDQFGGKISRTVELESPKGNVYVIKVSKHMNKTV
LQCGWEAFVDAHQIEENDSLLFRHIENSRFAVLILDSDGCEKVFSCSGKRRASGVQERNA
DPIDVSSSTHDDTAQSSGGERFARSESGSDSQHREEAKESGSSEHESSYDLVDPQIAPMP
GYVLSRGTNLSEAHEEKLDMLVQEIRPEIPLYVTTMKHSNVNSHHASLVIAKHYACAYFP
RTSQTITLKWHGKNRKWHPKFYIRKDQVGYILHGRWIDFVCHNHVKEGDICIFHLKNFTG
RKFRATVHLLRETIPHSFGALHIPKRFESRNGRMRLKMTDDRRVSSTECRRGTMEPSTTN
VKKEADNEQCNNGQGKRQETLNFDVSVGSSKPYLTADRVSLTEEQFRKVEENVHSIQSEG
PIYVSIMNKSNTLGRQFATRYLPEGEQTLTLLTTGTGKAWQVKMRPRSGDARMFTLGWRD
FVRDNRLQTEDICLFQLMKNNERGLAMTVHIIRHNERS
Download sequence
Identical sequences OMERI03G23110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]