SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI03G23160.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI03G23160.1
Domain Number 1 Region: 420-518
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.53e-23
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 56-156
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-22
Family B3 DNA binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 622-733
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-17
Family B3 DNA binding domain 0.0086
Further Details:      
 
Domain Number 4 Region: 281-348
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000549
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI03G23160.1
Sequence length 743
Comment pep:novel chromosome:ALNW00000000:3:24595961:24602519:1 gene:OMERI03G23160 transcript:OMERI03G23160.1 description:""
Sequence
MSPQYLCPSPFHFSLPDSFLPILIPDIQMGMLKIGKSCSVCKEWQEHCYWSHMADDCKHF
LTYMVGDFTESMIVPTRFSNNFNGHISEEVNLKPPSGRTWSIGVANSDTGELVLRSGWKE
FVDANGVQENDCLLFRYSGVSSFYVLIFDPSGCEKASPHFVENHGFGREEKSAGAEEGGR
DGDKNGHHQHQLEMTPHKNSSRCRSIPRACKRGLFSDEIEKKEVDHEDEDEDEDEDGEDR
YYFCRHGGRVTEYNLSDGDKEEISRVPVPVEPGNPVLVKGVSPEFAGRYLGPAVAREVVM
ERGGGGGDQWHVRFVRRESSRGFHGTGWRRFARDNGLLAHDVCLFELRLVGGAGAGDRLR
RRPRPTMKVHVLRRVRGRFFLGFFVSILIQMGMLKIGKNCSVCKEWQEHCYWSHMADHSK
HFLKHMVGDFTGSMTVPARFANNFNGHISEEVNLRSPSGKTWSIGVANSDAGELVLQSGW
KEFVDGNGIEEGDCLLFRYSGVSSFEVLIFDPSGCEKASPHFVGSHGFGGAENSAGAERG
GGNGRRTPPIVDGDNGHRHHLEMTLHRNSGRSIPRACKRSLFSDETGGRYGEYYFSRHGR
VAEYNLREEDREEISRVPVPVEPGNPVFVQVIHSSHVRSSKYCIVGVSPEFAGKYLGAVE
REVVLERESRGGEWHVLFVHRRNTRGFYGGGWRQFAGDNRLVAHDVCLFELMMVDAAAGR
NRRRPTMTVHVLRRVRGRFVLLR
Download sequence
Identical sequences OMERI03G23160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]