SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI03G31140.3 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI03G31140.3
Domain Number 1 Region: 205-392
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.84e-34
Family cAMP-binding domain 0.00067
Further Details:      
 
Domain Number 2 Region: 16-67,141-241
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-16
Family Voltage-gated potassium channels 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI03G31140.3
Sequence length 464
Comment pep:novel chromosome:ALNW00000000:3:33204709:33210556:1 gene:OMERI03G31140 transcript:OMERI03G31140.3 description:""
Sequence
MTILLLLFLLQFLPKVYHSIYIMRKMQKVTGYIFGTVWWGFGLNLFAYFIASHIAGGCWY
VLAIQRVASCLQEECKIKNTCNLISLACSKEMCFHLPWSDKNGLACNLSSFGQQNIPDCL
SGNGPFAYGIYKGALPVISSNSLAVKILYPIFWGLMTLSTFGNDLEPTSNWLEVIFSIIN
VLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDMEWWMRRRQLPSRLRQRVRKYERER
WAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVPLFHGMDDLILDNICDRLRPLVFS
GGEKVIREGDPVQRMVFVLQGKLRSTQPLAKGVVATCMLGAGNFLGDELLSWCLRRPFLD
RLPASSATFECVETAQAFCLDAPDLRFITEQFRYKFANEKLKRTARYYSSNWRTWAAVNI
QLAWRRYKARTTTPPSAGGPDDGDRRLRHYASMFMSLRPHDHLE
Download sequence
Identical sequences OMERI03G31140.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]