SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI04G15090.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G15090.1
Domain Number 1 Region: 121-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-28
Family B3 DNA binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  OMERI04G15090.1
Domain Number - Region: 616-689
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0863
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI04G15090.1
Sequence length 700
Comment pep:novel chromosome:ALNW00000000:4:21080470:21083505:1 gene:OMERI04G15090 transcript:OMERI04G15090.1 description:""
Sequence
MLTFMELAGPTEGDGGGSVDSQLWAACAGSMSSVPPVGAAVYYFPQGHAEQASAAVDLSS
ARVPPLVPCRVVAVRFMADAESDEVFAKIRLVPLRPGDAVVDVGEAAAAEARREEENSSR
PRPTSFAKTLTQSDANNGGGFSVPRFCAETIFPELDYSSEPPVQSVCAKDVHGVEWTFRH
IYRGTPRRHLLTTGWSPFVNKKQLTAGDSIVFMRDEGGNIHVGLRRAKRGFCSIGGDDES
LSSMPGWDQYRGLMRRNATATATGGRTPPKGKVPPENVLTAATRATSGQPFEVLYYPRAS
TPEFCVRAAAVRTAMAVQWCPGMRFKMAFETEDSSRISWFMGTVAGVQASDSVRWPQSPW
RLLQVTWDEPELLQNVKRVCPWLVELVSSMPNLHLPSFSPPRKKPRNPPYAELPLEGQIF
TGPVFPPNPMAHDHHHHHGFPFLPFPDSSAQPAGIQGARHAQFASPFPEFHIGNLQPNLM
LYAGIRLPPADRAAPAPRPPRIIISTDLTIGSPGKPDDAACSPSSGGKKIDDTKPGGFLL
FGQAILTEEQIKNGNSDGRPASPNWDAEKAPNASEGSDSGVTQGSPTKNTTPSWSLPYFG
GNNISRASEYELNPGQCKVFVESEAVGRSLDLSALSSFEELYACLSDMFSIGSDELRSHL
VYRSPAGEVKHAGDEPFCAFVKSARKLRILTDVGSDNLGD
Download sequence
Identical sequences A0A0E0DG71
OMERI04G15090.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]