SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI04G24270.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G24270.2
Domain Number 1 Region: 168-312
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-47
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 998-1142
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-47
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 3 Region: 1592-1671
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000363
Family PB1 domain 0.038
Further Details:      
 
Domain Number 4 Region: 762-837
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000054
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI04G24270.2
Sequence length 1695
Comment pep:novel chromosome:ALNW00000000:4:29028165:29044057:-1 gene:OMERI04G24270 transcript:OMERI04G24270.2 description:""
Sequence
MVAISELGLRVCASLVWSEEEEMSSSSAASIGPPQPPPPPAPPEEEKKCLNSELWHACAG
PLVCLPTVGTRVVYFPQGHSEQVAASTNKEVEGHIPNYPNLPAQLICQLHDVTMHADVET
DEVYAQMTLQPLNPVRRLGFLHDVCSAELLMVWRSEIFYAQEQNDAYLPAEMGIMSKQPT
NYFCKTLTASDTSTHGGFSVPRRAAERVFPPLDFTQQPPAQELIARDIHDIEWKFRHIFR
GQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPSSVLSSDS
MHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYIKAVFHTRISVGMRFRMLFET
EESSVRRYMGTITEVSDADPVRWPSSYWRSVKVGWDESTAGERPPRVSLWEIEPLTTFPM
YPSLFPLRVKHPWYSGVASLHDDSNALMWLRGVAGEGGFQSLNFQSPGIGSWGQQRLHPS
LLSSDHDQYQAVVAAAAASQSGGYLKQQFLHLQQPMQSPQEHCNLNPLLQQQILQQASQQ
QIINPDAQNIQTMLSPSAIQQQLQQLQQMQQVQNDQKQKIQPDQSYQVPTSAVLPSPTSL
PSHLREKFGFSDPNANSSSFITSSSSDNMLDSSFLQGSSKAVDLSRFNQPVASEQQQQQQ
AWKQKFMGSQSVSFGGSVLHNSPTSKDGSVENKIGRDVQNQSLFSPQVDSSSLLYNMVPN
LTSNVSDGNLSTIPSGSTYLQNAMYGCLDDSSGLLQNTGENDPATRTFVKVYKSGSVGRS
LDITRFSNYAELREELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWELRVCAS
LVWSEEEEMSSSSAASIGPPQPPPPPAPPEEGGWLEKKCLNSELWHACAGPLVCLPTVGT
RVVYFPQGHSEQVAASTNKEVEGHIPNYPNLPAQLICQLHDVTMHADVETDEVYAQMTLQ
PLNPVRRLGFLHDVCSAELLMVWRSEIFYAQEQNDAYLPAEMGIMSKQPTNYFCKTLTAS
DTSTHGGFSVPRRAAERVFPPLDFTQQPPAQELIARDIHDIEWKFRHIFRGQPKRHLLTT
GWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPSSVLSSDSMHIGLLAAAA
HAAATNSRFTIFYNPRASPSEFVIPLSKYIKAVFHTRISVGMRFRMLFETEESSVRRYMG
TITEVSDADPVRWPSSYWRSVKVGWDESTAGERPPRVSLWEIEPLTTFPMYPSLFPLRVK
HPWYSGVASLHDDSNALMWLRGVAGEGGFQSLNFQSPGIGSWGQQRLHPSLLSSDHDQYQ
AVVAAAAASQSGGYLKQQFLHLQQPMQSPQEHCNLNPLLQQQILQQASQQQIINPDAQNI
QTMLSPSAIQQQLQQLQQMQQVQNDQKQKIQPDQSYQVPTSAVLPSPTSLPSHLREKFGF
SDPNANSSSFITSSSSDNMLDSSFLQGSSKAVDLSRFNQPVASEQQQQQQAWKQKFMGSQ
SVSFGGSVLHNSPTSKDGSVENKIGRDVQNQSLFSPQVDSSSLLYNMVPNLTSNVSDGNL
STIPSGSTYLQNAMYGCLDDSSGLLQNTGENDPATRTFVKVYKSGSVGRSLDITRFSNYA
ELREELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDPWESFVNSVWYIKILSPED
VHKMGKQGNDPRYLS
Download sequence
Identical sequences A0A0E0DJY2
OMERI04G24270.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]