SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI05G17200.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI05G17200.1
Domain Number 1 Region: 481-592
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000562
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 115-228
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000693
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI05G17200.1
Sequence length 778
Comment pep:novel chromosome:ALNW00000000:5:21541260:21543894:1 gene:OMERI05G17200 transcript:OMERI05G17200.1 description:""
Sequence
MAQPPDAAAAAAVPPPVVIDRDVWHACAVPYSGVLPGVGTLVYYIPHGHIEQWAEDPALL
LSRLPDPIHPVPCTVADLVLDVDAESGEAYATISLLPGSHDDTTARRQVPAHGEPGFRFF
EKQLSPADVTSNALVLPAGAEHVLPPLDIAAYQTARLFDVRDLRGKRFEFVHIWDKKRCR
YMLGDLGVNDNDGWRGFVKAKRLATRDTVVFMSRGGGDGELLVGVRRAPRARGGHHPRPG
VEDNKVVSEVWLAMQGVTPFEVTYYPREGTFEFVVSRDEYIGFSFSPFYPFVPGTTVHLR
MNPLQIAQSISGTVRTFDHLRPWRMLEVDWDQAASPISYRIHRQVNSWQVLRQPQPAATT
SAVRIRDAIVATPQVQIMAPPRPPPPTTTTGMVPVIDHDIWLACATPYSGRLPVVGSAVY
YFPQGHAEQCHTCTTCLIPDNRHRLRCTSDDSYAMISLFPGDCYVTHRPLPAARDPVGGQ
REFCFFDKKLSPSDAAANGGGSGALFVIPKPSAAEHVLPRIPDLRVTNLQGGRWEFGHTW
SDADTDRRSSSHTLAAGWSAFVKAKRLCVGDTVIFMRRRPGGEPLVGVRRKPHGGMPVGI
PDKHVADAWLDASSAQPFRVTYCPWQGTAEFVVHREEVEGSPPLAPGTRVRLLMNPDDAR
RRSQPPVYGTVRDVHSRSEWRMLEVDWDRDSPLAPTMNRRVNSWQVQPVQLALPPQGSDE
EAAAATTSTAHAGDATTSAPSLALQLQTMASSSSSSAPIIPSRGSAFRIVNPRDGSQG
Download sequence
Identical sequences A0A0E0DT16
OMERI05G17200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]