SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OMERI06G00470.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI06G00470.1
Domain Number 1 Region: 26-129
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-26
Family B3 DNA binding domain 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI06G00470.1
Sequence length 196
Comment pep:novel chromosome:ALNW00000000:6:382529:383119:-1 gene:OMERI06G00470 transcript:OMERI06G00470.1 description:""
Sequence
MATIVAWESRNQLQGGGGSHGGGERREHMFEKVVTPSDVGKLNRLVVPKHYAEKYFPLGP
AARTSPAGTVLCFEDAHGGGGGDSTWRFRYSYWSSSQSYVITKGWSRYVRDKRLAAGDTV
SFCRAGARLFIDCRKRAAAVSSLVPPAAAALIKVQLPPSRPVVDEEEASCGRRCLRLFGV
DLQLLADAPPALDLQL
Download sequence
Identical sequences A0A0E0DVL9
OMERI06G00470.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]